Lus10027562 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49142 205 / 1e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G12770 130 / 4e-35 MEF22 mitochondrial editing factor 22 (.1)
AT4G25270 124 / 1e-33 OTP70 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G33680 124 / 5e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G15510 124 / 7e-33 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18520 121 / 3e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 120 / 2e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G04840 119 / 2e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G16470 118 / 2e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G05240 118 / 5e-31 MEF19 mitochondrial editing factor 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039703 133 / 2e-36 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018492 128 / 1e-34 AT4G18750 385 / 2e-123 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031714 123 / 1e-32 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004081 122 / 2e-32 AT3G63370 893 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000706 122 / 4e-32 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1)
Lus10024876 122 / 4e-32 AT3G12770 886 / 0.0 mitochondrial editing factor 22 (.1)
Lus10029436 120 / 9e-32 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026460 120 / 1e-31 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001220 119 / 3e-31 AT3G57430 1110 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G005700 236 / 2e-74 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G047600 127 / 3e-34 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G220300 126 / 7e-34 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.011G156800 125 / 2e-33 AT4G21300 842 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G152000 120 / 1e-31 AT3G12770 931 / 0.0 mitochondrial editing factor 22 (.1)
Potri.003G058700 117 / 1e-30 AT1G15510 1113 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G006800 117 / 1e-30 AT2G33680 780 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G018800 117 / 1e-30 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G108000 117 / 1e-30 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.003G041501 112 / 2e-30 AT2G34400 251 / 1e-79 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10027562 pacid=23144569 polypeptide=Lus10027562 locus=Lus10027562.g ID=Lus10027562.BGIv1.0 annot-version=v1.0
ATGGACGGAAATTACCGCTCAAACCCTTCCTTAGGGATCAAACTGATGAGGGCTTACGCAGCCTCTGGTCACGCCAGAGATGCACGCCGCATATTCGACG
GAATTACTGAGAAGAATGTCGTTTTCTTCAATGTCATGATTCGGAGCTACGTTAACAACCACTTCCATCGTGATGCGTTGGCTTTGTACAAAAACATATT
GAGTTCTGAAATCGTTCCTGATCATTACACGTTTCCTTGTGTTCTAAAGGCATGCTCTGGATCCGATAATCTGTGTCTCGGTGTCCAGATTCACGGTTGC
GTTATGAAAAATGGGCTCGACTCGAATCGGTACATAGTTAATTGCCTGGTTGCAATGTACGGGAAATGCAACCGTTTAAAGGAAGCTCGCCTGGTGCTCG
ATGAAATGCCTAGTAGAGATGTGGTTACGTGGAGTTCTTTGATTGCCGGGTGTGCTCAGAACGGACGTTTCGATGAGGCACTGGATTGTTGCAGAGAGAT
GGAGAGTTTGAAGCTTAAACCGGATTCGTCCACGATTCTCCCACAATGGCTAGCCCCCCACCGGCTGTGA
AA sequence
>Lus10027562 pacid=23144569 polypeptide=Lus10027562 locus=Lus10027562.g ID=Lus10027562.BGIv1.0 annot-version=v1.0
MDGNYRSNPSLGIKLMRAYAASGHARDARRIFDGITEKNVVFFNVMIRSYVNNHFHRDALALYKNILSSEIVPDHYTFPCVLKACSGSDNLCLGVQIHGC
VMKNGLDSNRYIVNCLVAMYGKCNRLKEARLVLDEMPSRDVVTWSSLIAGCAQNGRFDEALDCCREMESLKLKPDSSTILPQWLAPHRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49142 Tetratricopeptide repeat (TPR)... Lus10027562 0 1
AT2G48110 MED33B, REF4 reduced epidermal fluorescence... Lus10042689 2.0 0.7071
AT5G04050 RNA-directed DNA polymerase (r... Lus10036278 6.3 0.7683
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111 13.1 0.7360
AT5G66550 Maf-like protein (.1) Lus10040204 18.9 0.7240
AT3G25970 Pentatricopeptide repeat (PPR)... Lus10004002 19.0 0.7020
AT5G23200 unknown protein Lus10017393 27.9 0.6668
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10019213 31.2 0.6980
AT3G25970 Pentatricopeptide repeat (PPR)... Lus10030249 32.6 0.6764
AT3G49680 ATBCAT-3 ,BCAT3 branched-chain aminotransferas... Lus10011604 34.1 0.6350
AT1G09190 Tetratricopeptide repeat (TPR)... Lus10029853 37.2 0.6754

Lus10027562 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.