Plant FIBer expression Database

Lus10027566 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52960 179 / 3e-58 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039319
[exp]
242 / 4e-83 AT5G52960 185 / 1e-60 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G033700
[exp]
183 / 1e-59 AT5G52960 203 / 9e-68 unknown protein
Potri.016G123100
[exp]
172 / 1e-55 AT5G52960 167 / 6e-54 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11341 DUF3143 Protein of unknown function (DUF3143)
Representative CDS sequence
>Lus10027566 pacid=23144562 polypeptide=Lus10027566 locus=Lus10027566.g ID=Lus10027566.BGIv1.0 annot-version=v1.0
ATGTCGACCATCTCTTTCTCAATTATCGGAAGCAGCGTCCCTCCATCGCCATCCTTCCGCTTCTCAGCTCCTACGAAAACCAGCTACTTCCCCTCACTAC
ACTCCTCTTCCCTCCGGCCATCGCCGCCCTCTCTGCGCAGAAAATCCGTCAACTTACTCCCATGTAGATCGTCGTCGGAGTCGGAGGACGTCCCGGCGAG
CGAAGACGAAGACGACGATGAATGGCGGAAGAAGCTTCCGGAGAAAGAGAAGCCGCTCTACTCTCACAGCCTTCCTTGCATCGAGTCCTGGCTCAAGGGG
TTAGGGTTTTACCAGAGCAAAGAAGACCGCGCCGTTTGGAAGGTCGAGAACCCGGACTGGCATGCTCAGTTGTCGCTCGATGTCACTGACCTCTACATCA
GGTACATGAAGAGTGGGTCAGGAAACCTCGAGAAGGATGTTGAGAGGAGATTCAGTTACGCTCTGAGTAGAGAAGATATCGAGAATGCTGTCCTAGGAGG
ACCTTAG
AA sequence
>Lus10027566 pacid=23144562 polypeptide=Lus10027566 locus=Lus10027566.g ID=Lus10027566.BGIv1.0 annot-version=v1.0
MSTISFSIIGSSVPPSPSFRFSAPTKTSYFPSLHSSSLRPSPPSLRRKSVNLLPCRSSSESEDVPASEDEDDDEWRKKLPEKEKPLYSHSLPCIESWLKG
LGFYQSKEDRAVWKVENPDWHAQLSLDVTDLYIRYMKSGSGNLEKDVERRFSYALSREDIENAVLGGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52960 unknown protein Lus10027566
[exp]
0 1
AT3G09580 FAD/NAD(P)-binding oxidoreduct... Lus10027764
[exp]
2.8 0.9291
AT1G51100 unknown protein Lus10011316
[exp]
5.5 0.9177
AT4G16580 Protein phosphatase 2C family ... Lus10014413
[exp]
8.9 0.8852
AT3G27830 RPL12-A ribosomal protein L12-A (.1) Lus10013078
[exp]
9.2 0.9092
AT5G51110 Transcriptional coactivator/pt... Lus10022731
[exp]
11.7 0.9156
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Lus10016971
[exp]
13.6 0.9028
AT3G46780 PTAC16 plastid transcriptionally acti... Lus10016502
[exp]
14.3 0.9173
AT3G27850 RPL12-C ribosomal protein L12-C (.1) Lus10022261
[exp]
15.9 0.8987
AT1G19150 LHCA2*1, LHCA2*... photosystem I light harvesting... Lus10039912
[exp]
16.4 0.9150
AT1G19740 ATP-dependent protease La (LON... Lus10006131
[exp]
17.1 0.9073

Lus10027566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.