Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027601 pacid=23151317 polypeptide=Lus10027601 locus=Lus10027601.g ID=Lus10027601.BGIv1.0 annot-version=v1.0 ATGTCGAGAGTGATAGCGCCGACCATGTCGTCCCTCCTTGCCGTCTGCGACGTTCCAGCTTACTTCATCATGTGGCATTGTGCTCTATCTCTCGAGGAGA GTAAAGGAAGTTCTTTATGTGATAATGGCTTATCTGAAAGGGATATTGCTACTTGA
AA sequence Show only first row Show all	>Lus10027601 pacid=23151317 polypeptide=Lus10027601 locus=Lus10027601.g ID=Lus10027601.BGIv1.0 annot-version=v1.0 MSRVIAPTMSSLLAVCDVPAYFIMWHCALSLEESKGSSLCDNGLSERDIAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027601 [exp]	0	1
AT1G04560			AWPM-19-like family protein (....		Lus10033541 [exp]	3.5	0.7326
AT1G70710		CEL1 ,AtGH9B1	CELLULASE 1, glycosyl hydrolas...		Lus10031139 [exp]	4.1	0.7656
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Lus10025074 [exp]	5.5	0.7098
					Lus10014737 [exp]	6.5	0.7421
AT3G04060	NAC	ANAC046	NAC domain containing protein ...		Lus10033699 [exp]	7.9	0.7421
AT1G04520		PDLP2	plasmodesmata-located protein ...		Lus10028049 [exp]	9.2	0.7421
					Lus10019558 [exp]	10.2	0.7421
AT3G56330			N2,N2-dimethylguanosine tRNA m...		Lus10034220 [exp]	11.0	0.5371
AT4G16195			Plant self-incompatibility pro...		Lus10019768 [exp]	11.2	0.7421
					Lus10021773 [exp]	12.1	0.7421

Compare expression of checked genes

Lus10027601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.