Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31490 108 / 8e-33 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022943 [exp] 124 / 7e-35 AT1G19220 546 / 4e-177 indole-3-acetic acid inducible 22, AUXIN RESPONSE FACTOR11, auxin response factor 19 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G077400 [exp] 107 / 3e-32 AT2G31490 134 / 2e-43 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027603 pacid=23151259 polypeptide=Lus10027603 locus=Lus10027603.g ID=Lus10027603.BGIv1.0 annot-version=v1.0 ATGGGTGGAGGAATGGAGGCAAACAAGAACAAGTTCATCGAGGACTGGGGCGCCGCCCGTGAGAATCTGGAGCACAACTTCCGATGGACTCGTCGTAACT TCGCCCTTATTGGCTTGTTCGGCGTCGCCCTTCCATTCCTCGTTTACAAGGGCACCGTCAAGGAATTCGTGAGCCTTTTTCCTTTTCTCCTTTCCTATTC TTCTGCTGTGATCTGCGATCGCTCTACAATTTCTGTTCGTTTGTGA
AA sequence Show only first row Show all	>Lus10027603 pacid=23151259 polypeptide=Lus10027603 locus=Lus10027603.g ID=Lus10027603.BGIv1.0 annot-version=v1.0 MGGGMEANKNKFIEDWGAARENLEHNFRWTRRNFALIGLFGVALPFLVYKGTVKEFVSLFPFLLSYSSAVICDRSTISVRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31490			unknown protein		Lus10027603 [exp]	0	1
					Lus10030724 [exp]	2.8	0.8477
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10019084 [exp]	3.7	0.8507
AT3G12390			Nascent polypeptide-associated...		Lus10026133 [exp]	3.9	0.8332
AT5G24165			unknown protein		Lus10014921 [exp]	4.9	0.7891
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10023702 [exp]	5.5	0.7940
					Lus10042157 [exp]	6.0	0.7632
AT3G18510			unknown protein		Lus10042971 [exp]	6.9	0.8086
AT5G20180			Ribosomal protein L36 (.1.2)		Lus10019412 [exp]	7.9	0.7865
AT3G02120			hydroxyproline-rich glycoprote...		Lus10032981 [exp]	10.7	0.7623
AT2G28105			unknown protein		Lus10021424 [exp]	11.5	0.7826

Compare expression of checked genes

Lus10027603 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.