Lus10027607 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30880 37 / 0.0003 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020739 63 / 2e-13 AT2G30880 620 / 0.0 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2)
Lus10029819 55 / 2e-10 AT2G30880 607 / 0.0 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G205300 45 / 3e-07 AT2G30880 556 / 0.0 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2)
Potri.002G057300 44 / 1e-06 AT2G30880 573 / 0.0 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2)
PFAM info
Representative CDS sequence
>Lus10027607 pacid=23151241 polypeptide=Lus10027607 locus=Lus10027607.g ID=Lus10027607.BGIv1.0 annot-version=v1.0
ATGGCGAACCGAGCTTGCAAGGATAGAGAGCGAGCAGAGGAGAATGTTAGGGTTGCAGAGGCAGATGCTGAAGCTAGAGTCAAAGAAGCTACAGATCGAG
AGCACGCTGCTCTACAGGAGAAGCAAGAGCTTCTAGCGTATGTCAACGTATTGCAGGAGAAACTCCAACGGCAGCAAATGGATAACAAGCACGTTTAG
AA sequence
>Lus10027607 pacid=23151241 polypeptide=Lus10027607 locus=Lus10027607.g ID=Lus10027607.BGIv1.0 annot-version=v1.0
MANRACKDRERAEENVRVAEADAEARVKEATDREHAALQEKQELLAYVNVLQEKLQRQQMDNKHV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30880 Pleckstrin homology (PH) domai... Lus10027607 0 1
AT5G17390 Adenine nucleotide alpha hydro... Lus10007982 4.0 0.7513
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10026536 8.8 0.6541
AT4G18360 Aldolase-type TIM barrel famil... Lus10042495 10.2 0.6432
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Lus10005834 13.0 0.6386
Lus10039384 15.4 0.6168
Lus10034849 18.3 0.6148
AT5G16460 Putative adipose-regulatory pr... Lus10020213 18.7 0.5844
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10033233 22.0 0.6083
AT1G17930 Aminotransferase-like, plant m... Lus10021566 23.2 0.6083
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 24.4 0.6083

Lus10027607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.