Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19150 186 / 4e-59 LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA6, LHCA2*1, LHCA2*1, LHCA2*1, LH photosystem I light harvesting complex gene 6 (.1) AT3G61470 144 / 7e-43 LHCA2 photosystem I light harvesting complex gene 2 (.1) AT3G47470 110 / 8e-30 CAB4, LHCA4 light-harvesting chlorophyll-protein complex I subunit A4 (.1) AT1G45474 89 / 2e-21 LHCA5 photosystem I light harvesting complex gene 5 (.1.2) AT1G61520 69 / 4e-14 LHCA3*1, LHCA3*1, LHCA3*1 photosystem I light harvesting complex gene 3 (.1.2.3) AT1G15820 65 / 1e-12 CP24, LHCB6 light harvesting complex photosystem II subunit 6 (.1) AT3G54890 52 / 2e-08 LHCA1 photosystem I light harvesting complex gene 1 (.1.2.3.4) AT4G10340 48 / 9e-07 LHCB5 light harvesting complex of photosystem II 5 (.1) AT2G05100 45 / 1e-05 LHCB2.3, LHCB2.1 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.1 (.1) AT2G05070 45 / 1e-05 LHCB2.2 LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2, photosystem II light harvesting complex gene 2.2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039912 [exp] 303 / 4e-105 AT1G19150 362 / 2e-127 photosystem I light harvesting complex gene 6 (.1) Lus10011361 [exp] 145 / 6e-43 AT3G61470 414 / 6e-148 photosystem I light harvesting complex gene 2 (.1) Lus10006416 [exp] 145 / 7e-43 AT3G61470 404 / 6e-144 photosystem I light harvesting complex gene 2 (.1) Lus10021663 [exp] 114 / 5e-31 AT3G47470 434 / 2e-156 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Lus10001644 [exp] 114 / 5e-31 AT3G47470 437 / 3e-157 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Lus10021730 [exp] 89 / 4e-21 AT1G45474 369 / 2e-130 photosystem I light harvesting complex gene 5 (.1.2) Lus10042657 [exp] 89 / 4e-21 AT1G45474 371 / 3e-131 photosystem I light harvesting complex gene 5 (.1.2) Lus10012297 [exp] 69 / 8e-14 AT1G61520 474 / 2e-171 photosystem I light harvesting complex gene 3 (.1.2.3) Lus10016074 [exp] 69 / 8e-14 AT1G61520 474 / 2e-171 photosystem I light harvesting complex gene 3 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G139600 [exp] 194 / 3e-62 AT1G19150 393 / 1e-139 photosystem I light harvesting complex gene 6 (.1) Potri.003G171500 [exp] 147 / 6e-44 AT3G61470 409 / 5e-146 photosystem I light harvesting complex gene 2 (.1) Potri.001G056700 [exp] 147 / 1e-43 AT3G61470 410 / 3e-146 photosystem I light harvesting complex gene 2 (.1) Potri.015G062200 [exp] 114 / 4e-31 AT3G47470 442 / 2e-159 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Potri.014G029700 [exp] 89 / 2e-21 AT1G45474 306 / 3e-105 photosystem I light harvesting complex gene 5 (.1.2) Potri.014G172400 [exp] 67 / 2e-13 AT1G61520 362 / 3e-127 photosystem I light harvesting complex gene 3 (.1.2.3) Potri.003G020400 [exp] 66 / 7e-13 AT1G15820 421 / 9e-151 light harvesting complex photosystem II subunit 6 (.1) Potri.001G210000 [exp] 65 / 1e-12 AT1G15820 424 / 7e-152 light harvesting complex photosystem II subunit 6 (.1) Potri.008G041000 [exp] 54 / 8e-09 AT3G54890 395 / 4e-141 photosystem I light harvesting complex gene 1 (.1.2.3.4) Potri.010G221100 [exp] 52 / 5e-08 AT3G54890 392 / 4e-140 photosystem I light harvesting complex gene 1 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [flax] [poplar] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Lus10027649 pacid=23151225 polypeptide=Lus10027649 locus=Lus10027649.g ID=Lus10027649.BGIv1.0 annot-version=v1.0 ATGGCTCTCACAAGCATTCCGGCCACCCCCTTATCCCTCTGTAAATTTGGGACTTCTTCTTCTTCTTCCTCCCCTTATTGTTACAACAAACCTCTGAGAT CATCAGCATTCGTTATCACCAACGCAACGAAACCTGCCCCTGCTGTGTGTAAGCCCCTTCCTCCCGATAGACCACTCTGGTTCCCCGGCAGTTCAGCTCC GGCCTGGCTGAACGGCAGTCTGCCTGGTGATTTCGGATTCGACCCATTGGGTCTAGGGTTGGAGCCGGAGCAGCTAAAATGGATGGCGCAGGCGGAGCTG ATGCACGCGAGATGGGCGATGCTAGCGACTGCAGGGATACTCATTCCTGAAGCGATGGTGAGAGTCGACTTGCTTGACAACTTCAATTGGTACGACGCCG GCGCCAATGAGTACTTCGCCGATCCGGTGAGGTTGTTCGTGGTCCAGATGGGCCTAATGGGCTGGGCAGAAGGTAGGAGATGGGCTGATATGGTTAACCC GGGGTTCGTGGACATCGAGCCCGTGTTCCCACACAAGTCGAAGCACAAGGCGGTTGGGGTTACCCCGGAGGATTGTGGTTCGATTTTTGGGGGTGGGGGG ACGGGTCGCCGGAGCCCTTAA
AA sequence Show only first row Show all	>Lus10027649 pacid=23151225 polypeptide=Lus10027649 locus=Lus10027649.g ID=Lus10027649.BGIv1.0 annot-version=v1.0 MALTSIPATPLSLCKFGTSSSSSSPYCYNKPLRSSAFVITNATKPAPAVCKPLPPDRPLWFPGSSAPAWLNGSLPGDFGFDPLGLGLEPEQLKWMAQAEL MHARWAMLATAGILIPEAMVRVDLLDNFNWYDAGANEYFADPVRLFVVQMGLMGWAEGRRWADMVNPGFVDIEPVFPHKSKHKAVGVTPEDCGSIFGGGG TGRRSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19150		LHCA2*1, LHCA2*...	photosystem I light harvesting...		Lus10027649 [exp]	0	1
AT1G15980		PnsB1, NDH48, N...	Photosynthetic NDH subcomplex...		Lus10002312 [exp]	3.2	0.9035
AT4G34830		PDE346, MRL1	PIGMENT DEFECTIVE 346, MATURAT...		Lus10007565 [exp]	4.4	0.9105
AT4G34830		PDE346, MRL1	PIGMENT DEFECTIVE 346, MATURAT...		Lus10012180 [exp]	6.9	0.9010
AT5G05740		ATEGY2	ethylene-dependent gravitropis...		Lus10022806 [exp]	7.7	0.8485
AT3G18680			Amino acid kinase family prote...		Lus10033492 [exp]	8.5	0.8735
AT3G18890		AtTic62	translocon at the inner envelo...		Lus10042346 [exp]	11.8	0.9005
AT5G54630	C2H2ZnF		zinc finger protein-related (....		Lus10018388 [exp]	12.2	0.8633
AT3G56650			Mog1/PsbP/DUF1795-like photosy...		Lus10029785 [exp]	14.5	0.8933
AT5G61410		RPE, EMB2728	EMBRYO DEFECTIVE 2728, D-ribul...		Lus10019083 [exp]	22.2	0.8640
AT1G56500			haloacid dehalogenase-like hyd...		Lus10020699 [exp]	22.4	0.8728

Compare expression of checked genes

Lus10027649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.