Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031617 [exp] 100 / 2e-29 AT4G28240 72 / 4e-18 Wound-responsive family protein (.1) Lus10033728 [exp] 95 / 2e-27 AT4G28240 54 / 2e-11 Wound-responsive family protein (.1) Lus10039758 [exp] 66 / 7e-16 AT4G28240 59 / 5e-13 Wound-responsive family protein (.1) Lus10018535 [exp] 66 / 8e-16 AT4G28240 69 / 9e-17 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G147700 [exp] 51 / 3e-10 AT4G28240 63 / 1e-14 Wound-responsive family protein (.1) Potri.019G116300 [exp] 41 / 4e-06 AT4G28240 / Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10027667 pacid=23151219 polypeptide=Lus10027667 locus=Lus10027667.g ID=Lus10027667.BGIv1.0 annot-version=v1.0 ATGGCGGCCACCGTCACAGTAGTACAAGGTTCACACCCGAATGTGGGTGGTAGAAAATGGAGATCCGACACCCAGTCTCTCCACCATGGGAAGCGGCAGC TCTTCTCCTGCTTCGGCGTCGCTTCCAATCTCCGATCGCTTTCCAGATGCGCGATTGGGTTGGATCATATGGACGTTGGAGTGAGGCAAAGTGATGAATC GCTCCGGCGAGTCATGTAA
AA sequence Show only first row Show all	>Lus10027667 pacid=23151219 polypeptide=Lus10027667 locus=Lus10027667.g ID=Lus10027667.BGIv1.0 annot-version=v1.0 MAATVTVVQGSHPNVGGRKWRSDTQSLHHGKRQLFSCFGVASNLRSLSRCAIGLDHMDVGVRQSDESLRRVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027667 [exp]	0	1
					Lus10000273 [exp]	1.7	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	2.8	1.0000
AT1G04670			unknown protein		Lus10002298 [exp]	3.5	1.0000
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	4.5	1.0000
					Lus10032828 [exp]	4.9	1.0000
					Lus10015682 [exp]	5.0	1.0000
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	5.2	1.0000
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	5.3	1.0000
					Lus10019051 [exp]	5.5	1.0000
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	5.5	1.0000

Compare expression of checked genes

Lus10027667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.