Lus10027670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15470 196 / 3e-58 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G54200 186 / 4e-55 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G64610 72 / 1e-14 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT2G37670 70 / 4e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G42010 70 / 4e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G02430 67 / 4e-13 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G24320 65 / 2e-12 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G53500 61 / 8e-11 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G48870 60 / 2e-10 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039933 390 / 7e-141 AT3G15470 197 / 1e-58 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10024399 86 / 1e-19 AT2G37670 850 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10023033 85 / 3e-19 AT5G24320 508 / 3e-171 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10003206 85 / 4e-19 AT1G64610 427 / 1e-141 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10032436 84 / 1e-18 AT5G24320 516 / 1e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017312 78 / 1e-16 AT1G64610 439 / 4e-146 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10023797 66 / 2e-12 AT5G02430 423 / 7e-135 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003974 66 / 2e-12 AT2G37670 837 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10020846 65 / 2e-12 AT1G48870 407 / 3e-135 Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G122500 312 / 2e-101 AT3G15470 835 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G403400 312 / 5e-101 AT3G15470 828 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G086600 99 / 3e-24 AT5G24320 514 / 1e-173 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.003G144400 89 / 8e-21 AT5G24320 516 / 4e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G174100 79 / 2e-17 AT5G53500 523 / 1e-177 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G057600 73 / 3e-15 AT5G24320 384 / 3e-124 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.015G009700 71 / 1e-14 AT5G24320 621 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.012G018200 71 / 3e-14 AT5G24320 606 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.007G110500 69 / 6e-14 AT5G24320 411 / 1e-134 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.006G084600 67 / 4e-13 AT2G37670 920 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10027670 pacid=23151235 polypeptide=Lus10027670 locus=Lus10027670.g ID=Lus10027670.BGIv1.0 annot-version=v1.0
ATGTCATCCTCGGTCACAGCAAATGGGAAATTTGTTGTCTCGGCTAGCGAGGACTCATATGTCTACATATGGAAGCATGAGGCTGATTCACGGTTGACTA
GAAGCAAAGGTGTTACTGTGACTCGATCATATGAGCATTTCCATTGCCAAGATGTATCCGCTGCGATTCCATGGCCTGGAATTGGTGAAACTTGGGGACT
TGCCGAAAGTCTATGTAGTTTGCAAAATGGTCGAGATAGCCATCAAGATGAAGTCTCCATTGCAAACCATCCACCTACACCTGCAGAGGAAGTTAGTGGG
GGTGATCGGTCCCAATCATTGTCCGGATGCACAAGCAGTCCTCTGAATGGAATAATCTCCAGCGCAACAAATGGTTACTTCTTCGACAGAATCTCAGCAA
CATGGCCAGAGGAAAAACTGAATTTAGCCACTAGAAACCGTAGTCCTCGGACGAGTGTAGATGTGACCAATGGGCTGATGAACCAAAATATATCAGCTTA
TGGGATGGTGATTGTCACAGCTGGCCTAAGAGGAGAGATCAGAGCTTACCAAAATTTTGGTTTGCCAGTTCGAATATGA
AA sequence
>Lus10027670 pacid=23151235 polypeptide=Lus10027670 locus=Lus10027670.g ID=Lus10027670.BGIv1.0 annot-version=v1.0
MSSSVTANGKFVVSASEDSYVYIWKHEADSRLTRSKGVTVTRSYEHFHCQDVSAAIPWPGIGETWGLAESLCSLQNGRDSHQDEVSIANHPPTPAEEVSG
GDRSQSLSGCTSSPLNGIISSATNGYFFDRISATWPEEKLNLATRNRSPRTSVDVTNGLMNQNISAYGMVIVTAGLRGEIRAYQNFGLPVRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15470 Transducin/WD40 repeat-like su... Lus10027670 0 1
AT3G15470 Transducin/WD40 repeat-like su... Lus10039933 1.0 0.8849
AT5G20680 TBL16 TRICHOME BIREFRINGENCE-LIKE 16... Lus10027651 2.4 0.8467
AT3G54810 GATA GATA8, BME3, BM... GATA TRANSCRIPTION FACTOR 8, B... Lus10037994 8.0 0.8042
AT5G26670 Pectinacetylesterase family pr... Lus10010084 9.2 0.7959
AT2G04220 Plant protein of unknown funct... Lus10013755 11.4 0.7194
AT5G06700 TBR TRICHOME BIREFRINGENCE, Plant ... Lus10021066 13.4 0.8066
AT3G54810 GATA GATA8, BME3, BM... GATA TRANSCRIPTION FACTOR 8, B... Lus10009227 15.9 0.7762
AT4G37250 Leucine-rich repeat protein ki... Lus10030333 16.2 0.7766
AT5G39785 Protein of unknown function (D... Lus10015368 18.3 0.7829
AT4G02405 S-adenosyl-L-methionine-depend... Lus10038881 20.5 0.7959

Lus10027670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.