Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G10940 129 / 4e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G62500 105 / 7e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22142 100 / 4e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22120 95 / 2e-23 CWLP cell wall-plasma membrane linker protein (.1) AT4G15160 87 / 1e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G12520 79 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 79 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 74 / 6e-17 AZI1 azelaic acid induced 1 (.1) AT1G62510 73 / 1e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 71 / 4e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032262 [exp] 111 / 2e-30 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028930 [exp] 103 / 9e-28 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004349 [exp] 101 / 9e-27 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010482 [exp] 94 / 3e-25 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10003801 [exp] 96 / 6e-24 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010479 [exp] 81 / 9e-19 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032263 [exp] 75 / 2e-17 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024627 [exp] 75 / 2e-17 AT4G12520 136 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 74 / 2e-17 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G065500 [exp] 132 / 4e-39 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.018G126000 [exp] 128 / 3e-36 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G111300 [exp] 104 / 5e-28 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 100 / 5e-27 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 99 / 8e-26 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 96 / 1e-23 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 76 / 3e-18 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 69 / 2e-15 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G256100 [exp] 69 / 2e-15 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 66 / 3e-14 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027704 pacid=23151273 polypeptide=Lus10027704 locus=Lus10027704.g ID=Lus10027704.BGIv1.0 annot-version=v1.0 ATGGAGTTATCCTCCTTAGTCGTCATTTTGATGGTTTTCCTCTCTTCCTCCACCCCCATCCTCTCATGTAAGCATTGCCACCACCACCACAAACCCACCG GAAAACCGAAACCCCCCATCTCCGGCGGCATACTCCCTCCAATCCACTTGCCCAGCGTCCCAATCCCACCGGTGACAGTACCATCAATCAAGCCCCCAAA GCTCCTCCCTCCGGTCCCAATTACAAAGGGGAAGCCATGCCCACCTCCACCCCCAGCAGCTAAGAAGGACACGTGTCCTATAGACACTTTAAAGCTGGGA GCTTGTGTAAGTGGACTTGTTCACATTGGATTAGGTGAGCCGGTTATAGAAAAATGTTGTCCGATCCTGGCTGGTTTGGTGGAAATTGAGGCAGCAGCTT GCTTGTGCACTACTTTGAAGATGAAGGCATTGAATTTGAACATGTATGCTCCTCTGGCTATTCAACTTCTTATCACCTGTGGCAAGACCCCTCCCTCTGG CTACACTTGCTCCATTTGA
AA sequence Show only first row Show all	>Lus10027704 pacid=23151273 polypeptide=Lus10027704 locus=Lus10027704.g ID=Lus10027704.BGIv1.0 annot-version=v1.0 MELSSLVVILMVFLSSSTPILSCKHCHHHHKPTGKPKPPISGGILPPIHLPSVPIPPVTVPSIKPPKLLPPVPITKGKPCPPPPPAAKKDTCPIDTLKLG ACVSGLVHIGLGEPVIEKCCPILAGLVEIEAAACLCTTLKMKALNLNMYAPLAIQLLITCGKTPPSGYTCSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G10940			Bifunctional inhibitor/lipid-t...		Lus10027704 [exp]	0	1
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10004699 [exp]	2.4	0.9485
AT4G24510		VC2, VC-2, CER2	ECERIFERUM 2, HXXXD-type acyl-...		Lus10028171 [exp]	4.0	0.9467
AT1G03790	C3HZnF	SOM	SOMNUS, Zinc finger C-x8-C-x5-...		Lus10017708 [exp]	6.2	0.9357
AT1G11545		XTH8	xyloglucan endotransglucosylas...		Lus10007645 [exp]	12.6	0.9350
AT5G13870		EXGT-A4, XTH5, ...	endoxyloglucan transferase A4,...		Lus10030923 [exp]	13.3	0.9528
AT3G17120			unknown protein		Lus10037790 [exp]	14.1	0.9007
AT5G04190		PKS4	phytochrome kinase substrate 4...		Lus10040995 [exp]	18.7	0.9488
AT5G08580			Calcium-binding EF hand family...		Lus10017370 [exp]	20.2	0.8979
AT3G11590			unknown protein		Lus10013311 [exp]	20.4	0.9326
AT3G49720			unknown protein		Lus10007228 [exp]	20.9	0.9225

Compare expression of checked genes

Lus10027704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.