Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47320 120 / 5e-35 RPS19 ribosomal protein S19 (.1) ATCG00820 54 / 2e-10 ATCG00820.1, RPS19 ribosomal protein S19 (.1) AT5G43640 45 / 7e-07 Ribosomal protein S19 family protein (.1) AT5G09490 45 / 9e-07 Ribosomal protein S19 family protein (.1) AT5G09500 45 / 2e-06 Ribosomal protein S19 family protein (.1) AT1G04270 44 / 4e-06 RPS15 cytosolic ribosomal protein S15 (.1.2) AT5G09510 43 / 4e-06 Ribosomal protein S19 family protein (.1.2) AT5G63070 38 / 0.0005 Ribosomal protein S19 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003009 [exp] 182 / 3e-54 AT5G47040 1420 / 0.0 lon protease 2 (.1) Lus10026127 [exp] 50 / 1e-08 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1) Lus10008692 [exp] 50 / 1e-08 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1) Lus10021886 [exp] 44 / 5e-06 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1) Lus10024865 [exp] 43 / 6e-06 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1) Lus10033856 [exp] 43 / 7e-06 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2) Lus10018777 [exp] 43 / 7e-06 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2) Lus10041168 [exp] 44 / 8e-06 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2) Lus10007469 [exp] 43 / 8e-06 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G129600 [exp] 111 / 2e-32 AT5G47320 103 / 2e-28 ribosomal protein S19 (.1) Potri.019G101950 [exp] 77 / 2e-19 AT5G47320 74 / 1e-17 ribosomal protein S19 (.1) Potri.011G074301 [exp] 62 / 2e-13 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1) Potri.005G154674 [exp] 61 / 3e-13 ATCG00820 167 / 9e-56 ribosomal protein S19 (.1) Potri.013G137688 [exp] 61 / 3e-13 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1) Potri.013G129100 [exp] 46 / 2e-06 AT5G09950 1287 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.019G013302 [exp] 44 / 2e-06 ATCG00820 109 / 7e-33 ribosomal protein S19 (.1) Potri.008G161901 [exp] 42 / 3e-06 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2) Potri.010G076900 [exp] 43 / 7e-06 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2) Potri.002G043200 [exp] 41 / 4e-05 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00203 [flax] [poplar] Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence Show only first row Show all	>Lus10027711 pacid=23151251 polypeptide=Lus10027711 locus=Lus10027711.g ID=Lus10027711.BGIv1.0 annot-version=v1.0 ATGGATTCTACCATCGGACTAGCAGCCGCGATTGAAGAAGACGCCTCCGTCGACGGCGCCATCTCTATTCTTTCAACAGAGGCTCCTATGGCAAGAGCAA TGTGGAAGGGACCTTTTGTTGATGCTTTCCTATTGAAGTTGAAGAACAAGGGGGAACCACTTGCCAACAGGAAAATCTGGTCTCGCAGGTCAGTCATCTT GCCGGAGTTTCTGAATTCGACAGTCAGGATATACAACGGTAAGACGTTCGTCCGCTGCAAGATCACCGAAGGGAAGGTTGGTCACAAGTTTGGAGAGTTT GCACTGACGAGGAGGAGGAAGAAAATGAGAGGCAGTGACGCCAAAGGTGCTAATAAGAAGGTTGGGAAGAAGAAGTAG
AA sequence Show only first row Show all	>Lus10027711 pacid=23151251 polypeptide=Lus10027711 locus=Lus10027711.g ID=Lus10027711.BGIv1.0 annot-version=v1.0 MDSTIGLAAAIEEDASVDGAISILSTEAPMARAMWKGPFVDAFLLKLKNKGEPLANRKIWSRRSVILPEFLNSTVRIYNGKTFVRCKITEGKVGHKFGEF ALTRRRKKMRGSDAKGANKKVGKKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47320		RPS19	ribosomal protein S19 (.1)		Lus10027711 [exp]	0	1
AT5G23535			KOW domain-containing protein ...		Lus10042614 [exp]	4.9	0.9029
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	6.9	0.9016
AT2G45640		ATSAP18, HDA19	SIN3 ASSOCIATED POLYPEPTIDE 18...		Lus10041388 [exp]	8.5	0.8528
AT2G41950			unknown protein		Lus10016243 [exp]	9.8	0.8686
AT5G59850			Ribosomal protein S8 family pr...		Lus10029461 [exp]	11.0	0.8986
AT5G59850			Ribosomal protein S8 family pr...		Lus10005960 [exp]	11.0	0.8961
AT5G63310		NDPK1A, NDPKIAI...	NDP KINASE 1A, NUCLEOSIDE DIPH...		Lus10014787 [exp]	12.2	0.8526
AT3G14410			Nucleotide/sugar transporter f...		Lus10016923 [exp]	13.6	0.8536
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10035128 [exp]	14.0	0.8480
AT3G02080			Ribosomal protein S19e family ...		Lus10032992 [exp]	16.3	0.8939

Compare expression of checked genes

Lus10027711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.