Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44735 57 / 5e-12 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1.2) AT2G22860 45 / 3e-07 ATPSK2 phytosulfokine 2 precursor (.1) AT5G65870 39 / 4e-05 ATPSK5 phytosulfokine 5 precursor (.1) AT1G13590 38 / 0.0001 ATPSK1 phytosulfokine 1 precursor (.1) AT4G37720 37 / 0.0002 ATPSK6, ATPSK4 phytosulfokine 6 precursor (.1) AT3G49780 35 / 0.0009 ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATPSK4, ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATP phytosulfokine 4 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035572 [exp] 126 / 2e-39 AT3G44735 54 / 4e-11 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10020548 [exp] 50 / 2e-09 AT3G44735 55 / 8e-12 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10030916 [exp] 45 / 1e-07 AT1G13590 56 / 8e-12 phytosulfokine 1 precursor (.1) Lus10030572 [exp] 39 / 4e-05 AT1G13590 51 / 7e-10 phytosulfokine 1 precursor (.1) Lus10011721 [exp] 40 / 6e-05 AT3G49780 53 / 3e-10 phytosulfokine 4 precursor (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G148900 [exp] 52 / 5e-10 AT3G44735 65 / 2e-15 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Potri.004G188200 [exp] 49 / 7e-09 AT3G44735 69 / 9e-17 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Potri.007G006800 [exp] 41 / 4e-06 AT3G49780 60 / 1e-13 phytosulfokine 4 precursor (.1) Potri.014G006900 [exp] 38 / 7e-05 AT2G22860 52 / 2e-10 phytosulfokine 2 precursor (.1) Potri.002G116300 [exp] 37 / 0.0002 AT2G22860 50 / 5e-10 phytosulfokine 2 precursor (.1) Potri.009G085600 [exp] 36 / 0.0004 AT3G49780 68 / 1e-16 phytosulfokine 4 precursor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06404 [flax] [poplar] PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence Show only first row Show all	>Lus10027716 pacid=23156983 polypeptide=Lus10027716 locus=Lus10027716.g ID=Lus10027716.BGIv1.0 annot-version=v1.0 ATGGGAAGAAACCATTACTGTACTCTTCTTCTTATTGTTTTCCTGCTGGTTTCTTCACAAGCTGCTGATGCGAGGAGGATCTCTGTAGATGATCAGAAGG CTGGAGCAGAGCTTGCTTTTGGTTCATCATCAGCTTCTCTTGAAGAAGATTTCTCCATGGTGATGGGAGAAGGAGGAGTTGTGTGTGAAGACAAGGATGG AGAAGAAGAAGAATGCTTGAAGAGAAGGATGGTGGCTGAAGCTCACTTGGACTACATCTACACTCAGAGCCATAAACACCCTTGA
AA sequence Show only first row Show all	>Lus10027716 pacid=23156983 polypeptide=Lus10027716 locus=Lus10027716.g ID=Lus10027716.BGIv1.0 annot-version=v1.0 MGRNHYCTLLLIVFLLVSSQAADARRISVDDQKAGAELAFGSSSASLEEDFSMVMGEGGVVCEDKDGEEEECLKRRMVAEAHLDYIYTQSHKHP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10027716 [exp]	0	1
AT2G41110		ACAM-2, ATCAL5,...	calmodulin 2 (.1.2)		Lus10021487 [exp]	2.0	0.9483
AT5G05365			Heavy metal transport/detoxifi...		Lus10040965 [exp]	2.4	0.9416
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10035572 [exp]	3.5	0.9357
AT1G07400			HSP20-like chaperones superfam...		Lus10022604 [exp]	4.6	0.9237
AT2G43990			unknown protein		Lus10008165 [exp]	5.3	0.8991
AT1G76770			HSP20-like chaperones superfam...		Lus10018882 [exp]	5.5	0.9359
AT5G46030			unknown protein		Lus10015293 [exp]	6.8	0.9058
AT5G35732			unknown protein		Lus10001730 [exp]	7.1	0.9174
AT2G15680		AtCML30	calmodulin-like 30, Calcium-bi...		Lus10014050 [exp]	8.8	0.9239
					Lus10033890 [exp]	9.2	0.9260

Compare expression of checked genes

Lus10027716 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.