Lus10027735 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32700 210 / 7e-69 PLATZ transcription factor family protein (.1.2)
AT1G21000 210 / 1e-68 PLATZ transcription factor family protein (.1.2)
AT1G76590 207 / 1e-67 PLATZ transcription factor family protein (.1)
AT2G27930 205 / 2e-67 PLATZ transcription factor family protein (.1)
AT4G17900 196 / 2e-63 PLATZ transcription factor family protein (.1.2)
AT1G43000 184 / 1e-58 PLATZ transcription factor family protein (.1)
AT5G46710 167 / 4e-52 PLATZ transcription factor family protein (.1)
AT1G31040 130 / 3e-37 PLATZ transcription factor family protein (.1)
AT2G12646 120 / 2e-33 PLATZ transcription factor family protein (.1)
AT3G60670 117 / 2e-32 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035554 382 / 1e-136 AT1G21000 221 / 4e-73 PLATZ transcription factor family protein (.1.2)
Lus10014396 246 / 4e-83 AT1G76590 202 / 7e-66 PLATZ transcription factor family protein (.1)
Lus10023411 215 / 4e-69 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2)
Lus10040292 207 / 1e-67 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2)
Lus10000952 202 / 2e-65 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2)
Lus10002700 202 / 7e-65 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2)
Lus10040082 198 / 9e-64 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2)
Lus10030968 197 / 1e-63 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2)
Lus10020337 198 / 2e-63 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G119400 286 / 5e-99 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.016G097100 277 / 2e-95 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2)
Potri.001G212400 277 / 2e-95 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1)
Potri.009G003200 267 / 2e-91 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1)
Potri.005G259000 211 / 4e-69 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2)
Potri.002G002200 211 / 6e-69 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2)
Potri.019G051200 206 / 5e-67 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2)
Potri.003G092800 202 / 7e-66 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2)
Potri.013G078500 201 / 5e-65 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Potri.001G141500 198 / 6e-64 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10027735 pacid=23157057 polypeptide=Lus10027735 locus=Lus10027735.g ID=Lus10027735.BGIv1.0 annot-version=v1.0
ATGTCGGTGCCGGCGTGGCTAGAGTCACTGCTGAGCACCGCCTTCTTCTCCGTCTGCCGGATTCACCGCGACGCCGCGAGGAGCGAATGCAATATGTTCT
GTTTGGATTGCAGAGGAGATCCGTTCTGCTTCTATTGCCGCTCCTCCCGCCACAAGGACCACCAAGTAATACAGATTAGGAGATCTTCGTATCACGATGT
GGTGAGAGTCGGTGAAATACAGAAGGTTCTGGACATCAGCGGAGTACAGACGTATGTGATAAACAGCGCGAGAGTGATGTTCTTGAACGAGCGGCCGCAG
CCCAAGTCCGGCAAAGGAGTCGCTCATCTCTGTGAGATTTGTGGCCGGAGCTTGCTCGACACGTTTCGATTCTGCTCGTTGGGATGTAAGCTTGTAGGGA
TAAAGAAGAATGGGAATGCTACATTCACCATGGGAGGAGGAGAACATCATCAAAATAGAGAAGCTCAAACAAGTGCATCATCACCATTAATGTCAACATC
AAGAGAAGAAAACCAAGGAATGCGTCAAGGAACAACACAAGAAGAACAACAAGAAGAAGGAATCATGTACCCGCCAGCGACGCCACCGACTTCCAACGCA
CGGCGAAGAAAAGGCATTCCCCATCGCGCACCTTTCTTTGCTTCCTAA
AA sequence
>Lus10027735 pacid=23157057 polypeptide=Lus10027735 locus=Lus10027735.g ID=Lus10027735.BGIv1.0 annot-version=v1.0
MSVPAWLESLLSTAFFSVCRIHRDAARSECNMFCLDCRGDPFCFYCRSSRHKDHQVIQIRRSSYHDVVRVGEIQKVLDISGVQTYVINSARVMFLNERPQ
PKSGKGVAHLCEICGRSLLDTFRFCSLGCKLVGIKKNGNATFTMGGGEHHQNREAQTSASSPLMSTSREENQGMRQGTTQEEQQEEGIMYPPATPPTSNA
RRRKGIPHRAPFFAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G21000 PLATZ transcription factor fam... Lus10027735 0 1
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Lus10026345 1.7 0.9137
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Lus10005327 4.5 0.9184
AT1G76880 Trihelix Duplicated homeodomain-like su... Lus10018887 5.5 0.8948
AT3G28180 ATCSLC4, CSLC4,... CELLULOSE-SYNTHASE LIKE C4, Ce... Lus10039440 5.5 0.9151
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10023995 6.7 0.8959
Lus10019304 7.4 0.9073
AT1G21000 PLATZ transcription factor fam... Lus10035554 10.2 0.8508
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10004348 11.8 0.9098
AT4G36750 Quinone reductase family prote... Lus10040486 13.7 0.8831
AT4G12730 FLA2 FASCICLIN-like arabinogalactan... Lus10012344 14.7 0.8805

Lus10027735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.