Lus10027745 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22285 152 / 5e-43 Ubiquitin C-terminal hydrolases superfamily protein (.1)
AT4G22350 150 / 1e-42 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
AT4G22410 67 / 4e-13 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035548 199 / 4e-65 AT4G22410 102 / 3e-26 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Lus10003795 210 / 5e-65 AT4G22285 713 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Lus10010490 192 / 5e-58 AT4G22350 714 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
Lus10008452 42 / 0.0002 AT5G22030 1028 / 0.0 ubiquitin-specific protease 8 (.1.2)
Lus10008276 42 / 0.0003 AT4G10570 702 / 0.0 ubiquitin-specific protease 9 (.1)
Lus10013599 42 / 0.0004 AT5G22030 811 / 0.0 ubiquitin-specific protease 8 (.1.2)
Lus10013369 42 / 0.0004 AT5G22030 1065 / 0.0 ubiquitin-specific protease 8 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G010100 188 / 2e-56 AT4G22350 734 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
Potri.016G014000 183 / 1e-54 AT4G22350 699 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Representative CDS sequence
>Lus10027745 pacid=23156984 polypeptide=Lus10027745 locus=Lus10027745.g ID=Lus10027745.BGIv1.0 annot-version=v1.0
ATGGCTTGGCTTCTCTTCAGACTTCATTATGAGCTTACAACTTGGAACAAGAATATCAACATCATTTACGATTGCTTTCAGGGGGAAATTGAGGTTATCC
AAGAAGTGATCCGGCGTGGTGCTGATCACAGTGCCACTGGTACAGACGGTGAGACTGAACATAACAACGCTCTCAAGGAAACTTTGACAGAGGTGTTCTT
GGTGCTCGGTCTGGATTTGCCACCGCCTCTGTTGATGGAGAGTGATGTTATTCCACAGAAGATCGAGGAAGAGACCATCACCGAAGTAGACAAGGATAGT
GCCGTGAGGATGAACTGCCGCTTTACCAGATTGCCAAAGTATCTTATTCTTCACATGCAACGATTCAACAACAACATGGTCCCCCTCAAGAAGAACCAAA
CTCTAGTCAACTTTCCTGTGAAGAACTTGGAACTGAAGGACTGTATCTCTGTGCCTAGACCAAAGGAGGACGAGAACCCCTGCTCGGAGTACGACTTGAT
AGCTAACATCGTCCACGACGGCAAGCGAACAAGGAGGCTCCTACCGAGGTTCTGTGCAGCCCAAGTCGGAAGAGCTACGGTAAATATTAGATTGTACGAG
ATGCGGGGTCCAATGGTCTCCGAAACGCTTCCTCAGACGGTTGCTCTCTCTGAGGCATATCTGCAGATATACGAGCAGCATCAGTACTAA
AA sequence
>Lus10027745 pacid=23156984 polypeptide=Lus10027745 locus=Lus10027745.g ID=Lus10027745.BGIv1.0 annot-version=v1.0
MAWLLFRLHYELTTWNKNINIIYDCFQGEIEVIQEVIRRGADHSATGTDGETEHNNALKETLTEVFLVLGLDLPPPLLMESDVIPQKIEEETITEVDKDS
AVRMNCRFTRLPKYLILHMQRFNNNMVPLKKNQTLVNFPVKNLELKDCISVPRPKEDENPCSEYDLIANIVHDGKRTRRLLPRFCAAQVGRATVNIRLYE
MRGPMVSETLPQTVALSEAYLQIYEQHQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22285 Ubiquitin C-terminal hydrolase... Lus10027745 0 1
Lus10004996 2.0 1.0000
AT3G61150 HD HD-GL2-1, HDG1 HOMEODOMAIN-GLABRA2 1, homeodo... Lus10003300 4.2 1.0000
AT2G37890 Mitochondrial substrate carrie... Lus10006265 4.9 1.0000
Lus10003285 5.1 1.0000
Lus10000977 6.0 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10002747 6.5 1.0000
AT4G32630 ArfGap/RecO-like zinc finger d... Lus10022113 6.5 0.9473
AT1G20480 AMP-dependent synthetase and l... Lus10011621 6.9 1.0000
AT5G12060 Plant self-incompatibility pro... Lus10022829 7.3 1.0000
Lus10000363 8.1 1.0000

Lus10027745 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.