Lus10027754 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74270 196 / 4e-66 Ribosomal protein L35Ae family protein (.1)
AT1G07070 195 / 2e-65 Ribosomal protein L35Ae family protein (.1)
AT1G41880 192 / 3e-64 Ribosomal protein L35Ae family protein (.1)
AT3G55750 191 / 6e-64 Ribosomal protein L35Ae family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035539 205 / 2e-69 AT1G74270 215 / 4e-74 Ribosomal protein L35Ae family protein (.1)
Lus10021121 198 / 1e-65 AT1G07070 197 / 6e-66 Ribosomal protein L35Ae family protein (.1)
Lus10028254 192 / 3e-64 AT1G41880 207 / 3e-71 Ribosomal protein L35Ae family protein (.1)
Lus10040235 191 / 9e-64 AT1G41880 207 / 7e-71 Ribosomal protein L35Ae family protein (.1)
Lus10017188 166 / 3e-48 AT2G38010 1100 / 0.0 Neutral/alkaline non-lysosomal ceramidase (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G194200 194 / 3e-65 AT1G07070 219 / 8e-76 Ribosomal protein L35Ae family protein (.1)
Potri.008G063200 193 / 7e-65 AT1G07070 216 / 2e-74 Ribosomal protein L35Ae family protein (.1)
Potri.008G059400 193 / 8e-65 AT1G74270 216 / 1e-74 Ribosomal protein L35Ae family protein (.1)
Potri.010G199400 192 / 3e-64 AT1G07070 214 / 1e-73 Ribosomal protein L35Ae family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0575 EFTPs PF01247 Ribosomal_L35Ae Ribosomal protein L35Ae
Representative CDS sequence
>Lus10027754 pacid=23157091 polypeptide=Lus10027754 locus=Lus10027754.g ID=Lus10027754.BGIv1.0 annot-version=v1.0
ATGGTGAAGGAACGACAGGGAGAGCGCGTCAGGCTCTATGTTCGAGGAACGGTTCTCGGATACAAGAGGTCGAAGTCGAACCAGTACCCGAACACTTCGC
TGATTCAGATCGAGGGAGTGAACACCAAGGAAGAGGTGGATTGGTACAGGGGCAAGCGCATGGCGTATATCTACAAGGCTAAGGTGAAGAAGAATGGAAG
CCACTACCGCTGCATTTGGGGTAAGGTTACTAGGCCTCACGGTAACAGTGGTGTTGTTCGAGCCAAGTTCACGTCTAACCTTCCTCCCAAGTCAATGGTT
AATTGTGTGGTTACTGAATCTTACAGGGCGATAGAGTCAGGGTCTTCATGTATCCAAGCAACGTTTGAGGTGCCCATGGCAGAGTTGACCCTCTACCACT
CGAGCCTTAAGTTTCATCCTGTAGCCTTTGGCATTGCGTTTCTGAGAGCTTAG
AA sequence
>Lus10027754 pacid=23157091 polypeptide=Lus10027754 locus=Lus10027754.g ID=Lus10027754.BGIv1.0 annot-version=v1.0
MVKERQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYRGKRMAYIYKAKVKKNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMV
NCVVTESYRAIESGSSCIQATFEVPMAELTLYHSSLKFHPVAFGIAFLRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G74270 Ribosomal protein L35Ae family... Lus10027754 0 1
AT4G09320 NDPK1 Nucleoside diphosphate kinase ... Lus10003844 2.0 0.9679
AT4G24830 arginosuccinate synthase famil... Lus10012800 3.2 0.9458
AT3G06700 Ribosomal L29e protein family ... Lus10016875 5.1 0.9500
AT2G20585 NFD6 nuclear fusion defective 6 (.1... Lus10002171 5.5 0.9456
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10023730 6.5 0.9446
AT4G14320 Zinc-binding ribosomal protein... Lus10038130 6.6 0.9459
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10022057 7.1 0.9467
AT4G14320 Zinc-binding ribosomal protein... Lus10000176 10.4 0.9415
AT5G12110 Glutathione S-transferase, C-t... Lus10036101 10.6 0.9383
AT1G34030 Ribosomal protein S13/S18 fami... Lus10014676 11.0 0.9429

Lus10027754 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.