Lus10027768 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035527 325 / 6e-115 AT4G24640 40 / 4e-04 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10007598 142 / 1e-42 ND 42 / 2e-04
Lus10040145 108 / 2e-29 ND 40 / 4e-04
Lus10000961 106 / 6e-29 ND 39 / 5e-04
Lus10011019 90 / 6e-21 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
Lus10016318 42 / 0.0001 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012800 93 / 6e-24 ND /
Potri.005G022200 86 / 4e-21 ND /
Potri.013G012733 85 / 8e-21 ND /
Potri.005G022250 77 / 2e-17 ND /
Potri.005G022400 72 / 8e-16 ND /
Potri.005G022300 71 / 3e-15 ND /
Potri.005G195200 62 / 5e-12 AT5G64620 42 / 7e-05 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.003G122000 42 / 4e-05 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10027768 pacid=23156876 polypeptide=Lus10027768 locus=Lus10027768.g ID=Lus10027768.BGIv1.0 annot-version=v1.0
ATGAATTCCTCCATCACTGCCTCAATCATACTCTCATGCCTGATCACATTGCAACTTCTATTGTCTCAAGCAACCGCTCGACCAATCGCCCATCACGATC
GCCACTGCCTGAATCAAATCACACTACAGAAAGAAGTCTGCAACAGAACCTACGGCCTCGATTTCAACGTCTGCATCCGAACCTTGAGATCCGATCCCAA
GGCGTCAACCGCCGACAACGTCAAGGCCCTCGCCGTCGCCGTCTTCGAGACCACTAAGGAACAGTCGCTGAATCTGAGCCGGACGTTCGGGAAAATCGCG
ATACGCGACGGCGCGGGGAAGTCGGCGATGGAGATGTGCGCGTACTACTACAAGGACGCGGCGATCTTCTTCAGGCCGACGGGGTTGGGAGAGATGACGA
AGAGCCTCGAGTTGCATTCCGCGTTGGACGATTCGCACTACTGCGACGCCGCGTTGGAGACGAAGAAGGTTCGGCTTGATCGGTCCGTGGAGGAGGAGAT
TCGGAAGTGGAGGAAGCTTTACGCGATTGCGTACGGGATTGTGATGTACGCGGAGGATGTGTACGGCGGGACTGTTGGTTGA
AA sequence
>Lus10027768 pacid=23156876 polypeptide=Lus10027768 locus=Lus10027768.g ID=Lus10027768.BGIv1.0 annot-version=v1.0
MNSSITASIILSCLITLQLLLSQATARPIAHHDRHCLNQITLQKEVCNRTYGLDFNVCIRTLRSDPKASTADNVKALAVAVFETTKEQSLNLSRTFGKIA
IRDGAGKSAMEMCAYYYKDAAIFFRPTGLGEMTKSLELHSALDDSHYCDAALETKKVRLDRSVEEEIRKWRKLYAIAYGIVMYAEDVYGGTVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027768 0 1
Lus10024863 5.5 0.6756
AT5G03050 unknown protein Lus10012904 24.1 0.6226
Lus10022950 32.0 0.5981
AT2G38910 CPK20 calcium-dependent protein kina... Lus10015992 49.4 0.5720
AT5G49180 Plant invertase/pectin methyle... Lus10023775 97.8 0.5819
AT3G29090 PME31, ATPME31 A. THALIANA PECTIN METHYLESTER... Lus10024050 164.0 0.5283

Lus10027768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.