Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11210 78 / 1e-18 SGNH hydrolase-type esterase superfamily protein (.1) AT2G38180 55 / 5e-10 SGNH hydrolase-type esterase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035506 [exp] 138 / 2e-40 AT3G11210 244 / 7e-79 SGNH hydrolase-type esterase superfamily protein (.1) Lus10004815 [exp] 89 / 9e-23 AT3G11210 323 / 3e-112 SGNH hydrolase-type esterase superfamily protein (.1) Lus10040197 [exp] 84 / 1e-20 AT3G11210 402 / 5e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10028290 [exp] 79 / 9e-19 AT3G11210 402 / 2e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10027790 [exp] 61 / 6e-12 AT2G38180 194 / 1e-59 SGNH hydrolase-type esterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G100300 [exp] 96 / 9e-26 AT3G11210 327 / 8e-114 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116100 [exp] 91 / 9e-24 AT3G11210 337 / 9e-118 SGNH hydrolase-type esterase superfamily protein (.1) Potri.008G068000 [exp] 89 / 4e-23 AT3G11210 419 / 5e-150 SGNH hydrolase-type esterase superfamily protein (.1) Potri.010G189300 [exp] 84 / 7e-21 AT3G11210 414 / 4e-148 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G115800 [exp] 72 / 1e-16 AT3G11210 307 / 4e-106 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116000 [exp] 71 / 4e-16 AT3G11210 306 / 1e-105 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027793 pacid=23156972 polypeptide=Lus10027793 locus=Lus10027793.g ID=Lus10027793.BGIv1.0 annot-version=v1.0 ATGATCAGAGCTGCTTCACTTAAAAGAACCCTGTTCCTTGACTTACAAGCTAAGCTCGGTCTAAACTCTGAAGGACTCACTACGGACTTCTTTTGCAGAG ACGGGATCCATCTATCTGCAGAAGGGAGCAAGGTGGTGGTGAAGCAGATCCTGAAGGCAATCAAGGAAGCCGATTGGGAACCCAGTCTGGATTCCCGATC GCTTCCGACTGAATACTCAGAAGATTCTCCCTACGATCCGACCGGTCACGATGGAAGAACCATCAACCTCTCTGATCTCGACTTCAACAAAGCTGCCCTG TGGGAGTAG
AA sequence Show only first row Show all	>Lus10027793 pacid=23156972 polypeptide=Lus10027793 locus=Lus10027793.g ID=Lus10027793.BGIv1.0 annot-version=v1.0 MIRAASLKRTLFLDLQAKLGLNSEGLTTDFFCRDGIHLSAEGSKVVVKQILKAIKEADWEPSLDSRSLPTEYSEDSPYDPTGHDGRTINLSDLDFNKAAL WE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11210			SGNH hydrolase-type esterase s...		Lus10027793 [exp]	0	1
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Lus10042047 [exp]	5.5	0.8013
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10042533 [exp]	9.3	0.7985
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10021994 [exp]	12.8	0.7886
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10013306 [exp]	16.6	0.7850
AT1G80210		BRCC36A, AtBRCC...	BRCA1/BRCA2-containing complex...		Lus10030352 [exp]	19.3	0.7506
					Lus10007590 [exp]	26.1	0.6970
AT5G64180			unknown protein		Lus10013157 [exp]	26.5	0.7648
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Lus10000565 [exp]	28.8	0.7370
AT3G59490			unknown protein		Lus10013685 [exp]	33.9	0.7205
AT5G59460			scarecrow-like transcription f...		Lus10001576 [exp]	35.8	0.7781

Compare expression of checked genes

Lus10027793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.