Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06900 184 / 8e-56 CYP93D1 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) AT5G47990 167 / 3e-49 THAD1, THAD, CYP705A5 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1) AT2G45570 166 / 6e-49 CYP76C2 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) AT4G15350 165 / 2e-48 CYP705A2 "cytochrome P450, family 705, subfamily A, polypeptide 2", cytochrome P450, family 705, subfamily A, polypeptide 2 (.1) AT3G20090 160 / 9e-48 CYP705A18 "cytochrome P450, family 705, subfamily A, polypeptide 18", cytochrome P450, family 705, subfamily A, polypeptide 18 (.1) AT4G15360 163 / 1e-47 CYP705A3 "cytochrome P450, family 705, subfamily A, polypeptide 3", cytochrome P450, family 705, subfamily A, polypeptide 3 (.1) AT5G07990 162 / 2e-47 CYP75B1, D501, TT7 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) AT2G45550 162 / 2e-47 CYP76C4 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) AT3G20130 161 / 3e-47 GPS1, CYP705A22 gravity persistence signal 1, "cytochrome P450, family 705, subfamily A, polypeptide 22", cytochrome P450, family 705, subfamily A, polypeptide 22 (.1.2) AT4G31950 162 / 4e-47 CYP82C3 "cytochrome P450, family 82, subfamily C, polypeptide 3", cytochrome P450, family 82, subfamily C, polypeptide 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035502 [exp] 228 / 2e-72 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10027798 [exp] 217 / 4e-70 AT5G06900 349 / 1e-117 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10040868 [exp] 183 / 4e-55 AT5G06900 434 / 5e-148 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10005878 [exp] 183 / 4e-55 AT5G06900 440 / 1e-150 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10023827 [exp] 171 / 1e-50 AT2G42250 652 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Lus10013150 [exp] 169 / 7e-50 AT5G07990 403 / 4e-136 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10008112 [exp] 168 / 2e-49 AT5G07990 407 / 2e-137 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10028914 [exp] 165 / 3e-48 AT4G12320 461 / 3e-158 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10019457 [exp] 161 / 7e-47 AT3G48280 467 / 2e-161 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G058200 [exp] 264 / 2e-86 AT5G06900 584 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.016G049800 [exp] 241 / 2e-77 AT5G06900 536 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.016G049900 [exp] 199 / 5e-65 AT5G06900 217 / 9e-69 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.005G037100 [exp] 197 / 2e-60 AT5G06900 383 / 4e-128 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.005G037201 [exp] 197 / 3e-60 AT5G06900 382 / 6e-128 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.013G027000 [exp] 179 / 1e-53 AT5G06900 357 / 3e-118 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.016G052600 [exp] 176 / 3e-52 AT2G42250 512 / 2e-178 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.007G085000 [exp] 174 / 2e-51 AT5G07990 402 / 5e-135 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.007G084700 [exp] 171 / 1e-50 AT5G07990 397 / 5e-134 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.007G084200 [exp] 169 / 4e-50 AT3G26300 385 / 1e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10027796 pacid=23156977 polypeptide=Lus10027796 locus=Lus10027796.g ID=Lus10027796.BGIv1.0 annot-version=v1.0 ATGGACGTCGGAGGGGAGCTTGGTTGGGATGCTCAAGGGTTTGAGAAGAGGCTTAAGGATGTGAGAGATAGGTATGATGTTATGATGGAGAGGATTATTG CACAACATCAAGAGTTGAGGAGGAAAAGGAAGATTGAAGGAATTGATGGAACACACACATCTTCAACACTAGTAGAATGGGGACTCTCAGAACTCATCAA ACACCCATCCACAATGAACAAAGCAAGGCAGGAAATCAACTCGGTCGTGGGTCAAAACCGGCTAGTCCAAGAATCAGACATCCAAAACCTCCCCTATCTC CAAGCCATACTAAAAGAGCTACTCCGCCTCCACCCAACCGGCCCACTAGTGGTCCGAGAATTATCCGAGAAATGCACAGTCGCAGGCTACGAGATCCCGG CCAGGATGATACTGTTTGTGAATATATGGTCCCTGGGGAAGGACCCGAACCACTGGAAGGAGCCTGAAAAATTCGAGCCAGAGAGGTTCTTAGGGGAAGG GTGGGACGGAAAGGGTAACATGTTGGATGTTAGGGGTCAATATTTTCAGCTGTTGCCGTTTGGGAGCGGGAGGAGGAGCTGTCCGGGGCTTCGTTGGCTC TGCGATTCGTGCCGACGACATTGGCTGCGATGA
AA sequence Show only first row Show all	>Lus10027796 pacid=23156977 polypeptide=Lus10027796 locus=Lus10027796.g ID=Lus10027796.BGIv1.0 annot-version=v1.0 MDVGGELGWDAQGFEKRLKDVRDRYDVMMERIIAQHQELRRKRKIEGIDGTHTSSTLVEWGLSELIKHPSTMNKARQEINSVVGQNRLVQESDIQNLPYL QAILKELLRLHPTGPLVVRELSEKCTVAGYEIPARMILFVNIWSLGKDPNHWKEPEKFEPERFLGEGWDGKGNMLDVRGQYFQLLPFGSGRRSCPGLRWL CDSCRRHWLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Lus10027796 [exp]	0	1
AT4G02210			unknown protein		Lus10027531 [exp]	3.2	0.8153
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040327 [exp]	4.9	0.8677
AT4G18380			F-box family protein (.1.2)		Lus10013431 [exp]	8.1	0.8482
					Lus10039759 [exp]	15.9	0.8466
AT1G62340		ALE1	ABNORMAL LEAF-SHAPE 1, ABNORMA...		Lus10015559 [exp]	17.3	0.7935
					Lus10040066 [exp]	17.4	0.8456
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10026107 [exp]	18.5	0.8140
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10026130 [exp]	20.1	0.8086
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10015930 [exp]	20.8	0.7860
					Lus10037930 [exp]	22.6	0.7631

Compare expression of checked genes

Lus10027796 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.