Lus10027800 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32060 196 / 8e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
AT1G15930 190 / 4e-63 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021027 231 / 2e-79 AT2G32060 192 / 4e-64 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Lus10035501 240 / 2e-78 AT3G12150 333 / 3e-111 unknown protein
Lus10023825 197 / 8e-65 AT2G32060 168 / 3e-53 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G056200 228 / 5e-78 AT2G32060 201 / 9e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Potri.005G206300 223 / 3e-76 AT2G32060 201 / 2e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Potri.001G046600 215 / 3e-73 AT2G32060 194 / 8e-65 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Potri.003G181200 214 / 5e-73 AT2G32060 188 / 1e-62 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0101 PELOTA PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence
>Lus10027800 pacid=23157049 polypeptide=Lus10027800 locus=Lus10027800.g ID=Lus10027800.BGIv1.0 annot-version=v1.0
ATGTCGGGTGAAGAAGTTGCCGTCCAACAGCCTGAGGCTCCTCCGGCCGCAGCCCCTGCTCCTGCTCTCGGTGAGCCAATGGATTTGGAGACGGCATTGC
AACTCGTGCTGAGGAAGTCACTTGCTCATGGCGGTCTCACTAAGGGACTTCATGAGGCTGCAAAAGTGATTGAGAAGCATGCTGCTCAGCTTTGCGTATT
GGCAGAGGACTGCAACCAAGCAGACTATGTCAAGTTGGTGAAGGCTCTCTGTGCTGACCACAACGTCAGCTTGATGACTGTTCCCAGTGCCAAGACCCTT
GGTGAATGGGCTGGTCTGTGCAAGATCGATTCAGAGGGAAAGGCCAGGAAGGTGGTTGGATGCTCCTGTGTTGTTGTGAAGGATTTTGGTGAGGAAAGTG
AAGGGCTAAACATTGTTCAAGAGCATTTGAAATCTCTATAG
AA sequence
>Lus10027800 pacid=23157049 polypeptide=Lus10027800 locus=Lus10027800.g ID=Lus10027800.BGIv1.0 annot-version=v1.0
MSGEEVAVQQPEAPPAAAPAPALGEPMDLETALQLVLRKSLAHGGLTKGLHEAAKVIEKHAAQLCVLAEDCNQADYVKLVKALCADHNVSLMTVPSAKTL
GEWAGLCKIDSEGKARKVVGCSCVVVKDFGEESEGLNIVQEHLKSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10027800 0 1
AT4G16720 Ribosomal protein L23/L15e fam... Lus10007805 1.7 0.9789
AT3G11510 Ribosomal protein S11 family p... Lus10022693 3.2 0.9653
AT3G11940 AML1, ATRPS5A ARABIDOPSIS MINUTE-LIKE 1, rib... Lus10008436 3.5 0.9767
AT4G29410 Ribosomal L28e protein family ... Lus10012914 4.0 0.9527
AT5G59850 Ribosomal protein S8 family pr... Lus10040309 4.2 0.9498
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10032212 4.2 0.9649
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 4.2 0.9693
AT3G53740 Ribosomal protein L36e family ... Lus10024402 7.7 0.9663
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10020499 7.7 0.9480
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10035584 7.7 0.9608

Lus10027800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.