Lus10027810 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05570 56 / 1e-09 transducin family protein / WD-40 repeat family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005040 90 / 9e-24 ND /
Lus10001254 85 / 1e-21 AT5G05570 85 / 9e-20 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10002478 81 / 2e-20 AT5G05570 73 / 3e-16 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10040188 56 / 8e-10 AT2G40070 533 / 0.0 unknown protein
Lus10008717 53 / 1e-09 AT2G40070 52 / 5e-09 unknown protein
Lus10009082 54 / 5e-09 AT5G05570 358 / 6e-106 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10030399 47 / 2e-06 AT5G05570 977 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10037841 46 / 2e-06 AT5G05570 1009 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10037838 40 / 0.0004 AT2G40070 551 / 0.0 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G117800 69 / 4e-14 AT5G05570 900 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.006G101600 62 / 5e-13 AT5G05570 72 / 8e-16 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.016G117700 60 / 2e-12 AT5G05570 90 / 3e-22 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.010G187700 55 / 2e-09 AT5G05570 1069 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.008G069700 44 / 1e-05 AT5G05570 624 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10027810 pacid=23156967 polypeptide=Lus10027810 locus=Lus10027810.g ID=Lus10027810.BGIv1.0 annot-version=v1.0
ATGGCAGAGAACAAGACAGCAAGAGCACTACTCTTTGGGTCGAACGATGTTGCCACAAAGCCTAAGCCCATGACCCCCGAGGAAATAAGAGCCAAATACA
GGAAATCTGCTACGAATGTATCGGAAGCAGCTGCACATGCTAAGTCCATGCTTGAAGAAAGAAATGAGAAATTAGAGCAAATCAACCAGCACTCAGAGGA
GCTGGAGAATAGATCTCAAGACTATGCATCAATGGCAAAGGAGCTTGCCAAGAAAATGGACAAGAAGAAATGGTGGCAACTAGTTTTAGGACTCACAATT
CGCAGCTTCAAATGCAAGCGTGCACGCGGCGGTAGCCAAACAGAGGCATCAGTTGAGAGCCTCCATGATGAAGGACAAGGAAGAGGAGCTTGCCTTGTTC
TTGGAGATGAAGAAGCACAGGAACAAGCTACAGCAGCAACAGGAGCTTGA
AA sequence
>Lus10027810 pacid=23156967 polypeptide=Lus10027810 locus=Lus10027810.g ID=Lus10027810.BGIv1.0 annot-version=v1.0
MAENKTARALLFGSNDVATKPKPMTPEEIRAKYRKSATNVSEAAAHAKSMLEERNEKLEQINQHSEELENRSQDYASMAKELAKKMDKKKWWQLVLGLTI
RSFKCKRARGGSQTEASVESLHDEGQGRGACLVLGDEEAQEQATAATGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05570 transducin family protein / WD... Lus10027810 0 1
AT3G04030 GARP Homeodomain-like superfamily p... Lus10020264 2.8 0.9686
AT1G47271 Cystathionine beta-synthase (C... Lus10001964 3.5 0.9587
AT4G37445 unknown protein Lus10001408 4.5 0.9654
AT4G34350 HDR, CLB6, ISPH CHLOROPLAST BIOGENESIS 6, 4-hy... Lus10009762 4.8 0.9243
AT4G22370 unknown protein Lus10003793 5.9 0.9564
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10000180 6.5 0.9597
Lus10035048 9.5 0.9532
AT4G16400 unknown protein Lus10038791 9.9 0.9503
Lus10019472 11.2 0.9431
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10028432 11.8 0.9424

Lus10027810 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.