Lus10027821 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49290 56 / 1e-09 ATRLP56 receptor like protein 56 (.1)
AT1G74170 51 / 7e-08 AtRLP13 receptor like protein 13 (.1)
AT1G74190 51 / 7e-08 AtRLP15 receptor like protein 15 (.1)
AT1G45616 51 / 1e-07 AtRLP6 receptor like protein 6 (.1)
AT1G47890 49 / 3e-07 AtRLP7 receptor like protein 7 (.1)
AT2G14440 47 / 1e-06 Leucine-rich repeat protein kinase family protein (.1)
AT3G49750 47 / 1e-06 AtRLP44 receptor like protein 44 (.1)
AT2G23950 47 / 1e-06 Leucine-rich repeat protein kinase family protein (.1)
AT1G58190 47 / 3e-06 AtRLP9 receptor like protein 9 (.1.2)
AT5G16900 46 / 3e-06 Leucine-rich repeat protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005049 150 / 7e-45 AT2G14440 44 / 7e-12 Leucine-rich repeat protein kinase family protein (.1)
Lus10003387 126 / 4e-34 AT1G47890 394 / 3e-120 receptor like protein 7 (.1)
Lus10019693 115 / 2e-30 AT2G33050 295 / 1e-91 receptor like protein 26 (.1)
Lus10042239 115 / 3e-30 AT1G45616 395 / 1e-121 receptor like protein 6 (.1)
Lus10026415 114 / 1e-29 AT1G47890 424 / 3e-131 receptor like protein 7 (.1)
Lus10000228 109 / 2e-28 AT3G05370 231 / 3e-66 receptor like protein 31 (.1)
Lus10016402 104 / 2e-26 AT1G47890 313 / 4e-94 receptor like protein 7 (.1)
Lus10004313 102 / 2e-25 AT2G33060 335 / 5e-103 receptor like protein 27 (.1)
Lus10006825 102 / 2e-25 AT1G47890 377 / 6e-114 receptor like protein 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G120532 101 / 2e-25 AT1G45616 325 / 9e-98 receptor like protein 6 (.1)
Potri.016G120600 93 / 2e-22 AT1G47890 441 / 7e-137 receptor like protein 7 (.1)
Potri.001G128400 60 / 8e-11 AT1G45616 498 / 2e-159 receptor like protein 6 (.1)
Potri.016G126900 54 / 9e-09 AT1G45616 510 / 5e-165 receptor like protein 6 (.1)
Potri.016G127101 52 / 3e-08 AT1G47890 580 / 0.0 receptor like protein 7 (.1)
Potri.001G389100 50 / 1e-07 AT5G27060 468 / 1e-149 receptor like protein 53 (.1)
Potri.011G021400 50 / 1e-07 AT3G11080 375 / 2e-114 receptor like protein 35 (.1)
Potri.016G127000 50 / 2e-07 AT1G47890 588 / 0.0 receptor like protein 7 (.1)
Potri.011G164800 49 / 3e-07 AT5G56040 1435 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2)
Potri.001G262800 49 / 4e-07 AT2G34930 429 / 8e-135 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10027821 pacid=23156928 polypeptide=Lus10027821 locus=Lus10027821.g ID=Lus10027821.BGIv1.0 annot-version=v1.0
ATGAGGTCTTCTGGGCTGATAGGAACTCTACCGAAGACACTGGAAGTGGATGCAAGTGGAGACCACACTAACTTCTCCGTATATCCTCAGCTTCTGACAT
TATCACTTGCATCCTGCAATCTGAGGATATTTCCTGATCTCGGTAACCAATCAAGGCTAGAATCAGTAGACCTTTCAGGTAACAATATCAATGGGGTTGT
ACCTCCTTGGATTTTACCATCAACACTACATGATCTCAATCTTTCAAACGACAACCTAATTGGTGTTCAGGTACCTATTTCTCTCCCCAACCTCAGTTTC
CTAGACATGCATGAAAACAAACTCCAAGGTGATAGTCCAGTCATTTCATCACCATATCTTGACTATGTGGATTACTCCTACAAGACCGGAAATTTCATCT
TATACAGAGTCGAAGCCTCCACCACCGTCGCCGCCGACGACGACAATGATAATGCACCGGTAGCTCAGAGTAAACGGTTGGAGAATCGGTTTCAGTAG
AA sequence
>Lus10027821 pacid=23156928 polypeptide=Lus10027821 locus=Lus10027821.g ID=Lus10027821.BGIv1.0 annot-version=v1.0
MRSSGLIGTLPKTLEVDASGDHTNFSVYPQLLTLSLASCNLRIFPDLGNQSRLESVDLSGNNINGVVPPWILPSTLHDLNLSNDNLIGVQVPISLPNLSF
LDMHENKLQGDSPVISSPYLDYVDYSYKTGNFILYRVEASTTVAADDDNDNAPVAQSKRLENRFQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49290 ATRLP56 receptor like protein 56 (.1) Lus10027821 0 1
Lus10013380 2.0 0.8780
AT2G32885 Rapid alkalinization factor (R... Lus10000923 4.6 0.8962
AT3G27810 MYB AtMYB3, ATMYB21 ARABIDOPSIS THALIANA MYB DOMA... Lus10022259 9.5 0.8672
AT3G14880 unknown protein Lus10039196 15.6 0.8595
AT5G60010 ferric reductase-like transmem... Lus10019390 18.0 0.8500
Lus10027066 19.7 0.8500
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 21.3 0.8500
AT3G10710 RHS12 root hair specific 12 (.1) Lus10017118 21.7 0.7218
AT1G04670 unknown protein Lus10004041 22.8 0.8500
AT4G36590 MADS MADS-box transcription factor ... Lus10028490 23.2 0.6860

Lus10027821 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.