Lus10027823 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21380 97 / 9e-24 ARK3 receptor kinase 3 (.1)
AT1G11410 91 / 8e-22 S-locus lectin protein kinase family protein (.1)
AT1G11340 82 / 1e-18 S-locus lectin protein kinase family protein (.1)
AT1G65790 82 / 2e-18 ARK1 receptor kinase 1 (.1)
AT4G27290 76 / 1e-16 S-locus lectin protein kinase family protein (.1)
AT1G65800 75 / 4e-16 ARK2 receptor kinase 2 (.1)
AT4G27300 69 / 8e-14 S-locus lectin protein kinase family protein (.1)
AT1G11300 58 / 3e-10 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
AT1G61610 56 / 2e-09 S-locus lectin protein kinase family protein (.1)
AT1G61380 55 / 3e-09 SD1-29 S-domain-1 29 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005053 222 / 1e-69 AT1G11410 299 / 1e-90 S-locus lectin protein kinase family protein (.1)
Lus10013910 196 / 7e-59 AT1G11340 628 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10007610 176 / 1e-51 AT1G11410 693 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10007604 162 / 2e-46 AT1G11340 694 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10005136 155 / 1e-44 AT1G11340 471 / 2e-155 S-locus lectin protein kinase family protein (.1)
Lus10030767 127 / 2e-34 AT1G11340 670 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10017247 117 / 6e-31 AT1G11340 503 / 2e-166 S-locus lectin protein kinase family protein (.1)
Lus10025512 116 / 2e-30 AT1G11340 530 / 5e-177 S-locus lectin protein kinase family protein (.1)
Lus10013245 114 / 1e-29 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G035700 121 / 3e-32 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028300 111 / 9e-29 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G036400 110 / 1e-28 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G036100 109 / 4e-28 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G036600 108 / 5e-28 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G035800 107 / 1e-27 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028600 104 / 3e-26 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028466 102 / 8e-26 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028701 102 / 9e-26 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G125100 88 / 1e-20 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0168 PAN PF08276 PAN_2 PAN-like domain
Representative CDS sequence
>Lus10027823 pacid=23157025 polypeptide=Lus10027823 locus=Lus10027823.g ID=Lus10027823.BGIv1.0 annot-version=v1.0
ATGGAAGTTGTGGTCCTTTCACCAAGTGTCATTCCAGCCTTCTGTTCCCTTTTGAATGCGATTGTTTACCTGGCTATGAACCAAGATAACCCTCGAAAGT
GGGATTCGAGAGATAGGTCAGCTGGGTGTGTAAGAAAACAATCAGAATCGTCTTCTATCTGTGGGGGTGGAGAACGGTTTGTGAGAATGGAAAAAGTGAA
GATACCCGATACCTCAGCAGCGGTATTGACGGTTGAAGTGAGCATGAGTAAATCGAAATGCGAAGATGTTTGCAAGAACAACTGTTCGTGCTCTGCGTAT
GCTACCATCGATAACAATGGGAAAGGGACTTGTCGTTGGACATGGTACGGAGATCTCATAGATACAGTGGACTTGGCGGTCAATGCTTACGATCTATATG
TTCGTGTTGATGCTATTGAATTAGGTAAGATTGACAAGGTGATGGAAACAAATGATTCTATATATGCTGTCCTTAACTTCTCTGTTCTTCCATTGACGAC
CTAG
AA sequence
>Lus10027823 pacid=23157025 polypeptide=Lus10027823 locus=Lus10027823.g ID=Lus10027823.BGIv1.0 annot-version=v1.0
MEVVVLSPSVIPAFCSLLNAIVYLAMNQDNPRKWDSRDRSAGCVRKQSESSSICGGGERFVRMEKVKIPDTSAAVLTVEVSMSKSKCEDVCKNNCSCSAY
ATIDNNGKGTCRWTWYGDLIDTVDLAVNAYDLYVRVDAIELGKIDKVMETNDSIYAVLNFSVLPLTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10027823 0 1
AT2G39350 ABCG1 ATP-binding cassette G1, ABC-2... Lus10033663 3.0 0.6880
Lus10003693 12.1 0.6172
AT3G02645 Plant protein of unknown funct... Lus10015084 19.4 0.6071
AT1G30130 unknown protein Lus10028119 24.7 0.5985
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10016490 27.7 0.6156
AT3G55400 OVA1 OVULE ABORTION 1, methionyl-tR... Lus10001706 32.6 0.5649
AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 ... Lus10017825 34.5 0.6068
AT1G24420 HXXXD-type acyl-transferase fa... Lus10033658 40.9 0.5870
AT1G68390 Core-2/I-branching beta-1,6-N-... Lus10035828 43.8 0.5746
AT5G60710 Zinc finger (C3HC4-type RING f... Lus10037392 44.2 0.5594

Lus10027823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.