Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20930 159 / 1e-51 SNARE-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G136800 [exp] 167 / 1e-54 AT2G20930 264 / 1e-92 SNARE-like superfamily protein (.1) Potri.004G176500 [exp] 81 / 4e-21 AT2G20930 163 / 3e-53 SNARE-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [flax] [poplar] PF PF04628 [flax] [poplar] Sedlin_N Sedlin, N-terminal conserved region
Representative CDS sequence Show only first row Show all	>Lus10027833 pacid=23157063 polypeptide=Lus10027833 locus=Lus10027833.g ID=Lus10027833.BGIv1.0 annot-version=v1.0 ATGATCGTCTGTGTAGCCGTCGTCGGCCACCAGAACAATCCGCTCTACATACAGAGCTTCACCGAGGCCGACGACTCTCTGAAGCTCCACCACATCGTCC ACTGCTCCCTTGACGTCGTTGACGAGCGAGTGAACAATCCGAAGAAATCCGGGCCGACGCTGAACGAGACGTTCCTCGGATTGCTGTATCCAACTGAGAA TTATAAAGTGTACGGATATTTGACGAACACGAAGGTGAAGTTCATATTGGTGACGACTGATCTGGATGTCCGAGACGTGGATGTGAGAAATGTAAGTGTT GTTGCTGATTGCAGAATTTGGATGAATGTGAGTATTGTGTCCATTGTAGAGTTTGGCTAG
AA sequence Show only first row Show all	>Lus10027833 pacid=23157063 polypeptide=Lus10027833 locus=Lus10027833.g ID=Lus10027833.BGIv1.0 annot-version=v1.0 MIVCVAVVGHQNNPLYIQSFTEADDSLKLHHIVHCSLDVVDERVNNPKKSGPTLNETFLGLLYPTENYKVYGYLTNTKVKFILVTTDLDVRDVDVRNVSV VADCRIWMNVSIVSIVEFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20930			SNARE-like superfamily protein...		Lus10027833 [exp]	0	1
AT3G61260			Remorin family protein (.1)		Lus10017811 [exp]	5.3	0.7760
AT2G31680		AtRABA5d	RAB GTPase homolog A5D (.1)		Lus10026731 [exp]	17.8	0.7713
AT5G63640			ENTH/VHS/GAT family protein (....		Lus10012506 [exp]	23.0	0.7363
AT1G05870			Protein of unknown function (D...		Lus10025562 [exp]	28.1	0.7398
AT4G32000			Protein kinase superfamily pro...		Lus10001939 [exp]	31.9	0.7126
					Lus10010299 [exp]	33.8	0.7633
					Lus10025831 [exp]	35.0	0.7300
AT2G23970			Class I glutamine amidotransfe...		Lus10033793 [exp]	39.0	0.6950
AT2G46780			RNA-binding (RRM/RBD/RNP motif...		Lus10030202 [exp]	39.8	0.7168
AT4G17100			unknown protein		Lus10001086 [exp]	43.1	0.7007

Compare expression of checked genes

Lus10027833 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.