Lus10027834 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 179 / 7e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 147 / 2e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 144 / 4e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 142 / 2e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 142 / 2e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 135 / 1e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G22900 130 / 1e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 128 / 4e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 128 / 6e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 122 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005062 311 / 3e-108 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 245 / 5e-82 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 242 / 6e-81 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 230 / 3e-77 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 229 / 6e-77 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 220 / 5e-72 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 217 / 6e-71 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 209 / 9e-69 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 201 / 1e-65 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 186 / 1e-59 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 162 / 4e-50 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 160 / 1e-49 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 155 / 2e-47 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G009100 154 / 3e-47 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 154 / 4e-47 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 154 / 7e-47 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 153 / 8e-47 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 149 / 3e-45 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 147 / 3e-44 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10027834 pacid=23156873 polypeptide=Lus10027834 locus=Lus10027834.g ID=Lus10027834.BGIv1.0 annot-version=v1.0
ATGTCTCTACTCTATTTGACGGCCGTCCTTCTCATCTCAACGGCGGCGTCAACCGTCGCCAGCAACACCACCACCGGAGTGGACACGGTCACCAACATCG
AATTCTACTTCCACGACATCTTGAGCGGGAGCAACCCGACAGCCGTACAAGTCATCAAACCCCTATCCACCTCCTCCAACTTCTTTGGAATGGTCAACGT
GGCCGACGACCCGTTGACCGAGACATCCGACCCGAATTCCAAGCTAATCGGGCGGGCCCAGGGGCTATACGCCTCGGTGGGCCAAAACGACATCGCATTG
CTGATGGCTCTAAGCTACAACTTTGAAGATGGGCCTTACAAGGGGAGCTCACTCAGCATCATGGGTAAGAACCCGACCATGAAACCGACCAGGGAGCTGC
CCGTTTTAGGCGGGACCGGTTTGTTCAGGTTGGCACGTGGGTATGCGTCCCTTAAAACGGTGTCGCTTAACTCTGCGGGGGATGCGGTCGTACATTATAA
TGTGACTGTGTACACCCCGGCTAGTAGTGATTCAATCTCCCCGCTTTCTACCCCTGGCGATGGTAGTCGTGCTAGATCTTCGAACGCGGTTGATTCATCA
TCTTCTTCGTCCTCGGCGATCAAGGCTACGACAGGAGCATTCGGCTTTGTTTTTGGGTTCATTTTTTTGTTCAATGCTCTGTAA
AA sequence
>Lus10027834 pacid=23156873 polypeptide=Lus10027834 locus=Lus10027834.g ID=Lus10027834.BGIv1.0 annot-version=v1.0
MSLLYLTAVLLISTAASTVASNTTTGVDTVTNIEFYFHDILSGSNPTAVQVIKPLSTSSNFFGMVNVADDPLTETSDPNSKLIGRAQGLYASVGQNDIAL
LMALSYNFEDGPYKGSSLSIMGKNPTMKPTRELPVLGGTGLFRLARGYASLKTVSLNSAGDAVVHYNVTVYTPASSDSISPLSTPGDGSRARSSNAVDSS
SSSSSAIKATTGAFGFVFGFIFLFNAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10027834 0 1
AT5G20950 Glycosyl hydrolase family prot... Lus10001151 2.0 0.9462
AT5G18860 NSH3 nucleoside hydrolase 3, inosin... Lus10041249 4.9 0.9276
AT1G24430 HXXXD-type acyl-transferase fa... Lus10025729 5.9 0.9190
AT3G56230 BTB/POZ domain-containing prot... Lus10010216 9.8 0.9231
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Lus10015127 9.8 0.9336
AT1G24430 HXXXD-type acyl-transferase fa... Lus10035932 18.8 0.9182
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10035901 19.2 0.8263
AT2G16750 Protein kinase protein with ad... Lus10019787 20.1 0.9124
AT5G14340 MYB AtMYB40 myb domain protein 40 (.1) Lus10014569 20.2 0.9006
AT5G05340 Peroxidase superfamily protein... Lus10008581 20.4 0.8769

Lus10027834 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.