Lus10027836 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21090 234 / 3e-74 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G02750 175 / 6e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G25360 172 / 6e-50 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39350 167 / 1e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G46790 166 / 4e-48 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G28690 162 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G29760 164 / 3e-47 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G40410 162 / 1e-46 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G57430 163 / 2e-46 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G13410 156 / 2e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005064 357 / 3e-124 AT2G21090 513 / 2e-179 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10040577 168 / 9e-51 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018223 169 / 1e-48 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004892 168 / 4e-48 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040680 166 / 1e-47 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009269 165 / 1e-47 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004987 162 / 1e-47 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015898 164 / 7e-47 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014956 157 / 1e-46 AT5G13230 484 / 1e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G027800 178 / 4e-52 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G067500 174 / 4e-50 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G085500 170 / 3e-49 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.013G058900 169 / 2e-48 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G037600 165 / 7e-48 AT3G46790 997 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G041200 166 / 1e-47 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G104700 164 / 5e-47 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G136200 164 / 5e-47 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.002G155100 164 / 5e-47 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G053600 162 / 8e-47 AT3G04750 759 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10027836 pacid=23156880 polypeptide=Lus10027836 locus=Lus10027836.g ID=Lus10027836.BGIv1.0 annot-version=v1.0
ATGGATGTTAATAATAATAAGAAAGATGTTGTTCTATGGAACACTATGCTTTCCACCTTGGCGCAACACGGTCGTGGGGAGGAGGCTATTCGATTTCTCG
ACGAGATGGTTTGTTTTGGGATAGTACCGAACAGGATAACGTTGGTTATCATGCTGAACGCTTGCAGTCATTCGGGGCTAATAGAGGAAGGGGTTAAAGT
TTTCGATTCCATGACAGGGAATCATAGCATTGTACCGGATGAGGAGCATTACGCTTGCTTGATCGATCTCCTCGGACGAGCCGGAGTTTTCGAGGGATTA
GCGAACCAGCTCCGGATGCTGCCACCAAGTGAGAAGATTTGGAGCGCATTGCTCGGTGTTTGTAGCATCCACGGGAACATGGAGTTGGGGAAAACGGCAG
ATGGACAGCTTATGAAGATGCAGCCGAGATCCCCTGCGGCGTATTTATTGCTGTCGAGTGTTTATGGTGCACTTGGGAGATGGGATTTGGTAGAGAAGGT
TAGAGAAATCATGGAGAGAAGGGGCATTAGGAAAGAAGAGGGGCTTAGATGGATAGAGAAAGGAACATCCATGACGGCAGAAGAAGAAGAAGAAGCTGTG
TGA
AA sequence
>Lus10027836 pacid=23156880 polypeptide=Lus10027836 locus=Lus10027836.g ID=Lus10027836.BGIv1.0 annot-version=v1.0
MDVNNNKKDVVLWNTMLSTLAQHGRGEEAIRFLDEMVCFGIVPNRITLVIMLNACSHSGLIEEGVKVFDSMTGNHSIVPDEEHYACLIDLLGRAGVFEGL
ANQLRMLPPSEKIWSALLGVCSIHGNMELGKTADGQLMKMQPRSPAAYLLLSSVYGALGRWDLVEKVREIMERRGIRKEEGLRWIEKGTSMTAEEEEEAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10027836 0 1
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10019939 5.5 0.6061
AT2G03210 ATFUT2, FUT2 fucosyltransferase 2 (.1) Lus10024079 7.1 0.5360
AT1G05750 PDE247, CLB19 pigment defective 247, Tetratr... Lus10001853 36.0 0.5555
AT5G06430 Thioredoxin superfamily protei... Lus10021764 49.7 0.5477
AT5G62440 Protein of unknown function (D... Lus10024824 58.0 0.4682
AT1G30670 bHLH bHLH052 basic helix-loop-helix (bHLH) ... Lus10038432 97.5 0.4858
AT1G77400 unknown protein Lus10042737 139.0 0.4866
AT4G18650 transcription factor-related (... Lus10007282 141.6 0.4669
AT4G17720 RNA-binding (RRM/RBD/RNP motif... Lus10035919 146.7 0.4538

Lus10027836 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.