Lus10027846 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 289 / 2e-102 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G53300 288 / 5e-102 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 288 / 9e-102 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G41700 286 / 4e-101 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08690 281 / 5e-99 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT2G16740 279 / 2e-98 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT5G56150 274 / 2e-96 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT3G08700 245 / 9e-85 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 160 / 5e-51 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 150 / 2e-47 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005072 309 / 6e-106 AT4G27960 291 / 3e-98 ubiquitin conjugating enzyme 9 (.1.2)
Lus10032352 288 / 6e-102 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10022726 288 / 1e-101 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 288 / 1e-101 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10033937 286 / 4e-101 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10039323 286 / 5e-101 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 286 / 5e-101 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 285 / 9e-101 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 285 / 9e-101 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G175000 297 / 2e-105 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.019G131400 291 / 4e-103 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.006G110200 290 / 2e-102 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 289 / 3e-102 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.003G136200 288 / 7e-102 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 287 / 2e-101 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 286 / 3e-101 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 286 / 3e-101 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G471200 281 / 3e-99 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.011G168200 279 / 2e-98 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10027846 pacid=23156980 polypeptide=Lus10027846 locus=Lus10027846.g ID=Lus10027846.BGIv1.0 annot-version=v1.0
ATGGCATCCAGGAGAATACTCAAGGAGCTGAGAGAGTTGCAGAGAGACCCTCCAACTTCTTGCAGTGCGGGTCCTGTGGCACAAGATATGTTCCATTGGC
AAGCAACAATCATGGGTCCAAATGACAGCCCTTATGCTGGTGGTGTTTTCCTTGTATCCATCCATTTCCCACCTGATTACCCTTTCAAACCTCCCAAGGT
GGCTTTCAGGACTAAGGTGTTCCATCCGAATGTAAACAGCAATGGGAACATATGCCTTGACATACTCAAAGAGCAATGGAGCCCTGCCCTTACCATCTCC
AAGGTATTGCTATCGATTTGTTCGCTGTTGACCGATCCGAACCCGGATGACCCGCTGGTGCCAGAGATAGCCCATATGTGCAAGAATGACAAGTTGAAGT
ATGAAGCAACTGCTCGTAGCTGGACCCAGAAATATGCCATGGGCTGA
AA sequence
>Lus10027846 pacid=23156980 polypeptide=Lus10027846 locus=Lus10027846.g ID=Lus10027846.BGIv1.0 annot-version=v1.0
MASRRILKELRELQRDPPTSCSAGPVAQDMFHWQATIMGPNDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNVNSNGNICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMCKNDKLKYEATARSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10027846 0 1
AT4G27960 UBC9 ubiquitin conjugating enzyme 9... Lus10005072 1.4 0.9459
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10040735 2.0 0.9388
AT2G18196 Heavy metal transport/detoxifi... Lus10008284 3.5 0.9453
AT1G09812 unknown protein Lus10035787 4.5 0.9245
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Lus10024300 4.6 0.9066
AT1G76040 CPK29 calcium-dependent protein kina... Lus10017251 4.9 0.9340
AT3G25855 Copper transport protein famil... Lus10021687 5.7 0.9217
Lus10016958 6.0 0.9253
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Lus10033405 6.2 0.9432
AT5G64240 AtMCP1a, ATMC3 metacaspase 1a, metacaspase 3 ... Lus10035630 7.4 0.9356

Lus10027846 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.