Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15395 84 / 1e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039067 [exp] 111 / 2e-34 AT3G15395 83 / 3e-23 unknown protein Lus10038792 [exp] 104 / 7e-32 AT3G15395 80 / 3e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G402000 [exp] 83 / 3e-23 AT3G15395 79 / 1e-21 unknown protein Potri.006G225232 [exp] 63 / 2e-15 AT3G15395 58 / 3e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027849 pacid=23157090 polypeptide=Lus10027849 locus=Lus10027849.g ID=Lus10027849.BGIv1.0 annot-version=v1.0 ATGGGAGGGCGTGGTGTTATAGGTGATAAATGGTCCATGAGGATTCTCTGGCTGTGTGCTATCGGAAGTGCAGCTGGTCTGTACATGGTTGCAGTTGAAA GACAAGCGCAGAACAGACACCGGATGATGGCCGAAGCTCTAATGAGTCTGGACGACGATGGCGACGATGTCTAG
AA sequence Show only first row Show all	>Lus10027849 pacid=23157090 polypeptide=Lus10027849 locus=Lus10027849.g ID=Lus10027849.BGIv1.0 annot-version=v1.0 MGGRGVIGDKWSMRILWLCAIGSAAGLYMVAVERQAQNRHRMMAEALMSLDDDGDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15395			unknown protein		Lus10027849 [exp]	0	1
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10017291 [exp]	2.2	0.7959
AT1G31790			Tetratricopeptide repeat (TPR)...		Lus10035697 [exp]	3.2	0.7743
AT1G71080			RNA polymerase II transcriptio...		Lus10042948 [exp]	3.5	0.7709
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10006517 [exp]	8.0	0.7413
AT5G04000			unknown protein		Lus10018038 [exp]	14.0	0.7635
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10003857 [exp]	17.5	0.7355
					Lus10030382 [exp]	18.7	0.7133
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10027365 [exp]	20.3	0.7473
AT2G40300		ATFER4	ferritin 4 (.1)		Lus10007523 [exp]	21.4	0.7313
AT1G64810		APO1	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10039122 [exp]	23.6	0.7548

Compare expression of checked genes

Lus10027849 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.