Lus10027854 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34880 103 / 1e-27 Amidase family protein (.1)
AT5G64440 42 / 6e-06 ATFAAH fatty acid amide hydrolase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002805 135 / 7e-40 AT4G34880 454 / 3e-158 Amidase family protein (.1)
Lus10027853 100 / 3e-26 AT4G34880 462 / 4e-159 Amidase family protein (.1)
Lus10025066 98 / 2e-25 AT4G34880 484 / 3e-168 Amidase family protein (.1)
Lus10027852 97 / 3e-25 AT4G34880 489 / 3e-170 Amidase family protein (.1)
Lus10002804 96 / 9e-25 AT4G34880 257 / 2e-90 Amidase family protein (.1)
Lus10034477 91 / 2e-23 AT4G34880 258 / 3e-82 Amidase family protein (.1)
Lus10020468 45 / 6e-07 AT5G64440 781 / 0.0 fatty acid amide hydrolase (.1)
Lus10007094 43 / 5e-06 AT5G64440 795 / 0.0 fatty acid amide hydrolase (.1)
Lus10016685 41 / 2e-05 AT5G64440 453 / 2e-152 fatty acid amide hydrolase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G169400 121 / 9e-35 AT4G34880 419 / 1e-144 Amidase family protein (.1)
Potri.009G130700 120 / 5e-34 AT4G34880 528 / 0.0 Amidase family protein (.1)
Potri.004G171000 118 / 5e-33 AT4G34880 535 / 0.0 Amidase family protein (.1)
Potri.009G130500 104 / 6e-28 AT4G34880 500 / 2e-174 Amidase family protein (.1)
Potri.009G130400 96 / 7e-25 AT4G34880 489 / 1e-170 Amidase family protein (.1)
Potri.004G169300 93 / 8e-24 AT4G34880 493 / 7e-172 Amidase family protein (.1)
Potri.004G171300 92 / 2e-23 AT4G34880 473 / 5e-164 Amidase family protein (.1)
Potri.005G070300 49 / 2e-08 AT5G64440 488 / 1e-166 fatty acid amide hydrolase (.1)
Potri.007G098600 44 / 2e-06 AT5G64440 478 / 2e-162 fatty acid amide hydrolase (.1)
Potri.001G285900 40 / 4e-05 AT5G64440 769 / 0.0 fatty acid amide hydrolase (.1)
PFAM info
Representative CDS sequence
>Lus10027854 pacid=23156945 polypeptide=Lus10027854 locus=Lus10027854.g ID=Lus10027854.BGIv1.0 annot-version=v1.0
ATGCTGGACAATTATTTGGATGCTTTGGTGACTCCTGGCCCTGGGATTTCACCAATCCTTGCCATAGGAGGATTCCCTGGGATCAATGTTCCTGCTGGTT
ATAATAAGAATGGTGTCCCCTTTGGGATTAGCTTTGGTGGGTTGAAAGGTGCTGAGCCTAAGTCGATCCAATTGGCTTATGGGTTTGAGCAAGCCACCAA
GATTAGGAAGCCTCCGACCTCCCTCGCTTGA
AA sequence
>Lus10027854 pacid=23156945 polypeptide=Lus10027854 locus=Lus10027854.g ID=Lus10027854.BGIv1.0 annot-version=v1.0
MLDNYLDALVTPGPGISPILAIGGFPGINVPAGYNKNGVPFGISFGGLKGAEPKSIQLAYGFEQATKIRKPPTSLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34880 Amidase family protein (.1) Lus10027854 0 1

Lus10027854 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.