Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25470 79 / 2e-18 AtRLP21 receptor like protein 21 (.1) AT3G53240 78 / 3e-18 AtRLP45 receptor like protein 45 (.1) AT1G74180 76 / 2e-17 AtRLP14 receptor like protein 14 (.1) AT5G49290 75 / 3e-17 ATRLP56 receptor like protein 56 (.1) AT1G74190 74 / 1e-16 AtRLP15 receptor like protein 15 (.1) AT1G58190 73 / 2e-16 AtRLP9 receptor like protein 9 (.1.2) AT2G32660 71 / 1e-15 AtRLP22 receptor like protein 22 (.1) AT5G48380 70 / 2e-15 BIR1 BAK1-interacting receptor-like kinase 1 (.1) AT1G54470 69 / 3e-15 RPP27 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2) AT4G04220 69 / 6e-15 AtRLP46 receptor like protein 46 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029288 [exp] 132 / 7e-40 AT1G07390 129 / 8e-34 receptor like protein 1 (.1.2.3) Lus10027856 [exp] 121 / 2e-33 AT1G74190 272 / 1e-77 receptor like protein 15 (.1) Lus10002804 [exp] 119 / 9e-33 AT4G34880 257 / 2e-90 Amidase family protein (.1) Lus10042381 [exp] 114 / 6e-31 AT1G74190 289 / 1e-82 receptor like protein 15 (.1) Lus10030068 [exp] 89 / 4e-22 AT5G49290 397 / 3e-124 receptor like protein 56 (.1) Lus10026415 [exp] 80 / 6e-19 AT1G47890 424 / 3e-131 receptor like protein 7 (.1) Lus10042239 [exp] 76 / 2e-17 AT1G45616 395 / 1e-121 receptor like protein 6 (.1) Lus10016402 [exp] 75 / 3e-17 AT1G47890 313 / 4e-94 receptor like protein 7 (.1) Lus10038598 [exp] 72 / 4e-16 AT3G47570 671 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G064900 [exp] 97 / 8e-25 AT1G07390 290 / 7e-83 receptor like protein 1 (.1.2.3) Potri.018G144700 [exp] 95 / 3e-24 AT1G07390 362 / 5e-109 receptor like protein 1 (.1.2.3) Potri.005G013200 [exp] 95 / 3e-24 AT1G58190 453 / 1e-142 receptor like protein 9 (.1.2) Potri.001G065327 [exp] 94 / 1e-23 AT1G07390 352 / 3e-105 receptor like protein 1 (.1.2.3) Potri.003G041600 [exp] 93 / 1e-23 AT1G74170 333 / 2e-98 receptor like protein 13 (.1) Potri.018G144800 [exp] 93 / 2e-23 AT1G74170 284 / 1e-81 receptor like protein 13 (.1) Potri.018G148000 [exp] 93 / 2e-23 AT1G74190 354 / 1e-106 receptor like protein 15 (.1) Potri.018G144300 [exp] 92 / 3e-23 AT2G25470 348 / 8e-105 receptor like protein 21 (.1) Potri.018G124400 [exp] 92 / 3e-23 AT1G07390 342 / 1e-101 receptor like protein 1 (.1.2.3) Potri.001G064600 [exp] 92 / 4e-23 AT1G74180 347 / 5e-105 receptor like protein 14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10027855 pacid=23157024 polypeptide=Lus10027855 locus=Lus10027855.g ID=Lus10027855.BGIv1.0 annot-version=v1.0 ATGCGTGGGATAGATTTTTCAAGCAACAATTTCACTGGAGAGATCCCTTCTGAAATTGGTCTCAAGCTCACATATATTACAGTGCTCAACTTATCCTACA ACAAGCTTGAAGGACAAATTCCATTGACGTTTTCAAACCTACACAGTATTGAAAGTCTGGATCTTTCTCACAACAATCTAAGTGGAAGAATTCCCCAACT CACTGCGCTAACCTCCCTTGAAGTCTTTGATGTGGCATGCAATACAAACACGAGGACCACTATTACTGCCAACAACTTCTCATGA
AA sequence Show only first row Show all	>Lus10027855 pacid=23157024 polypeptide=Lus10027855 locus=Lus10027855.g ID=Lus10027855.BGIv1.0 annot-version=v1.0 MRGIDFSSNNFTGEIPSEIGLKLTYITVLNLSYNKLEGQIPLTFSNLHSIESLDLSHNNLSGRIPQLTALTSLEVFDVACNTNTRTTITANNFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25470		AtRLP21	receptor like protein 21 (.1)		Lus10027855 [exp]	0	1
					Lus10007927 [exp]	2.0	1.0000
					Lus10023587 [exp]	2.4	1.0000
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	3.0	1.0000
AT3G19540			Protein of unknown function (D...		Lus10028040 [exp]	4.0	1.0000
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10031542 [exp]	4.5	1.0000
AT1G48120			hydrolases;protein serine/thre...		Lus10015869 [exp]	4.9	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10016922 [exp]	5.3	1.0000
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10039026 [exp]	5.7	1.0000
AT2G34320			Polynucleotidyl transferase, r...		Lus10039942 [exp]	6.0	1.0000
AT5G42230		SCPL41	serine carboxypeptidase-like 4...		Lus10023444 [exp]	6.2	0.9774

Compare expression of checked genes

Lus10027855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.