Lus10027859 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57240 185 / 4e-58 BG3 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
AT3G57270 184 / 8e-58 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
AT3G57260 180 / 2e-56 AtPR2, PR-2, PR2, BG2, BGL2 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
AT4G16260 179 / 1e-55 Glycosyl hydrolase superfamily protein (.1)
AT5G56590 154 / 5e-45 O-Glycosyl hydrolases family 17 protein (.1)
AT2G27500 137 / 9e-40 Glycosyl hydrolase superfamily protein (.1.2.3)
AT1G77780 135 / 8e-39 Glycosyl hydrolase superfamily protein (.1)
AT2G01630 135 / 1e-38 O-Glycosyl hydrolases family 17 protein (.1.2)
AT5G20340 134 / 2e-38 BG5 beta-1,3-glucanase 5 (.1)
AT5G20390 134 / 3e-38 Glycosyl hydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002807 343 / 3e-120 AT3G57240 339 / 7e-116 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Lus10027860 271 / 1e-91 AT3G57260 322 / 4e-109 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
Lus10014108 224 / 7e-71 AT3G57270 366 / 3e-123 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10019801 216 / 3e-70 AT3G57270 367 / 6e-127 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10014109 211 / 3e-68 AT3G57270 361 / 1e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10014110 196 / 1e-62 AT3G57270 359 / 2e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10019800 189 / 4e-61 AT3G57270 238 / 1e-77 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10016883 191 / 1e-60 AT4G16260 391 / 1e-136 Glycosyl hydrolase superfamily protein (.1)
Lus10031037 164 / 5e-50 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G046100 206 / 3e-66 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.016G057400 202 / 8e-65 AT3G57270 416 / 4e-146 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.006G048100 193 / 2e-61 AT3G57270 382 / 6e-133 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.016G057600 191 / 1e-60 AT3G57270 414 / 2e-145 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.010G143166 188 / 2e-59 AT4G16260 432 / 5e-153 Glycosyl hydrolase superfamily protein (.1)
Potri.001G255100 187 / 4e-59 AT4G16260 369 / 9e-128 Glycosyl hydrolase superfamily protein (.1)
Potri.010G142800 184 / 1e-57 AT4G16260 433 / 2e-152 Glycosyl hydrolase superfamily protein (.1)
Potri.009G050401 158 / 1e-48 AT4G16260 263 / 2e-87 Glycosyl hydrolase superfamily protein (.1)
Potri.009G050300 159 / 2e-48 AT4G16260 285 / 5e-95 Glycosyl hydrolase superfamily protein (.1)
Potri.002G089200 147 / 1e-43 AT1G77780 309 / 6e-104 Glycosyl hydrolase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence
>Lus10027859 pacid=23156927 polypeptide=Lus10027859 locus=Lus10027859.g ID=Lus10027859.BGIv1.0 annot-version=v1.0
ATGGGCAATACATACCCGCCGGACCAAGGCGCTTTCAACCAAGCTTATATGGGCCTTCTAAGGCCCATATTGGACTTTTTAGCGGCCAATCAATCCCCGA
TGCTATTAAACTTGTACCCGTTTTTCAGCCACCGTGACAACCCGGTTCAAGTGCTACTTAACTATGCTCTATTCAGAGGTCCGCCCGACCAAGGAACCGG
GTACGAAAACCTTTTCTTTGCAATGTTGGATTCCACGTACTATGCCCTGGAACGAGAAGGAAAGGAGAGTCTGAACATCGTAGTGTCGGAGAGCGGGTGG
CCGTCGGCAGGAGGAGGGGCTCCGACAACAGTGGATAATGCAAGGACTTACAACAACAATTTGGTACAACAGGTTAAAAGAGGGACACCAAAGCGTCCCG
GTAGACCAATTGAGACGTATATTTTCGCAATGTTTGACGAAGGGGACAAGGGTGGGGAACCGCTGGAGAAACATTTTGGGCTGTTTAGTCCTAATAGGCA
GCCAAAGTATCCGATGAGGTTCGACTAA
AA sequence
>Lus10027859 pacid=23156927 polypeptide=Lus10027859 locus=Lus10027859.g ID=Lus10027859.BGIv1.0 annot-version=v1.0
MGNTYPPDQGAFNQAYMGLLRPILDFLAANQSPMLLNLYPFFSHRDNPVQVLLNYALFRGPPDQGTGYENLFFAMLDSTYYALEREGKESLNIVVSESGW
PSAGGGAPTTVDNARTYNNNLVQQVKRGTPKRPGRPIETYIFAMFDEGDKGGEPLEKHFGLFSPNRQPKYPMRFD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57240 BG3 "beta-1,3-glucanase 3", beta-1... Lus10027859 0 1
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10029945 3.5 0.8762
AT3G60580 C2H2ZnF C2H2-like zinc finger protein ... Lus10008523 5.2 0.8572
AT5G48380 BIR1 BAK1-interacting receptor-like... Lus10034279 10.7 0.8384
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10003942 12.4 0.8632
AT5G26170 WRKY ATWRKY50, WRKY5... ARABIDOPSIS THALIANA WRKY DNA-... Lus10006848 17.5 0.8379
AT4G08850 Leucine-rich repeat receptor-l... Lus10005016 18.6 0.8393
AT1G23850 unknown protein Lus10030860 19.1 0.8420
AT5G10770 Eukaryotic aspartyl protease f... Lus10000265 20.5 0.8058
AT2G31880 SOBIR1, EVR SUPPRESSOR OF BIR1 1, EVERSHED... Lus10033041 22.9 0.7948
AT5G53110 RING/U-box superfamily protein... Lus10019018 25.7 0.7736

Lus10027859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.