Lus10027880 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34131 81 / 1e-17 UGT73B3 UDP-glucosyl transferase 73B3 (.1)
AT2G15480 77 / 2e-16 UGT73B5 UDP-glucosyl transferase 73B5 (.1.2)
AT4G34135 69 / 1e-13 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2)
AT4G34138 69 / 1e-13 UGT73B1 UDP-glucosyl transferase 73B1 (.1)
AT2G15490 67 / 4e-13 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3)
AT2G36750 64 / 6e-12 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1)
AT2G36790 64 / 9e-12 UGT73C6 UDP-glucosyl transferase 73C6 (.1)
AT2G36800 62 / 5e-11 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1)
AT2G36780 61 / 8e-11 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36770 57 / 1e-09 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019835 79 / 1e-16 AT2G15480 476 / 3e-165 UDP-glucosyl transferase 73B5 (.1.2)
Lus10014083 78 / 2e-16 AT4G34131 489 / 2e-170 UDP-glucosyl transferase 73B3 (.1)
Lus10014081 75 / 2e-16 AT2G15490 109 / 3e-28 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10019832 74 / 3e-15 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014086 74 / 3e-15 AT2G15490 496 / 4e-173 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014084 71 / 5e-14 AT2G15490 445 / 2e-153 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10016268 67 / 6e-13 AT2G36780 498 / 1e-173 UDP-Glycosyltransferase superfamily protein (.1)
Lus10023939 66 / 2e-12 AT2G36780 485 / 7e-169 UDP-Glycosyltransferase superfamily protein (.1)
Lus10014438 65 / 2e-12 AT2G36780 206 / 2e-63 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G098400 90 / 1e-20 AT2G15490 505 / 8e-177 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.009G099032 84 / 1e-18 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.001G302400 83 / 3e-18 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.009G098966 74 / 2e-15 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303000 73 / 5e-15 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303600 73 / 5e-15 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303300 72 / 1e-14 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G303700 72 / 1e-14 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G302300 67 / 5e-13 AT4G34131 488 / 4e-170 UDP-glucosyl transferase 73B3 (.1)
Potri.002G123700 61 / 7e-11 AT4G34131 446 / 3e-153 UDP-glucosyl transferase 73B3 (.1)
PFAM info
Representative CDS sequence
>Lus10027880 pacid=23156976 polypeptide=Lus10027880 locus=Lus10027880.g ID=Lus10027880.BGIv1.0 annot-version=v1.0
ATGGATACCACCGACCCGAGCCGAAAGCTCCATATCATCTTCCTCCCGTTCATGACATACGGCCACATGATTCCGATGATCGACATCGCCAAGCTCTTCG
CCGCTCAGGGAGTCAAATCCACCGTCGTCACCACTCCACTCAACGCCCACCTCTTCTCCAACCAAAAACAAAACCTCCTCCGGCGTCGAAGTCCGGCTCA
TCCTGTTCCCCGCCGCGGTAGTTGGGCTGCCGGAGTAATCGGAGTCCGCCGACTTCATCTCCTCCAACGCAAAGCGGCTGGATCCGGATTTCGTCGCCAG
ATTTCTCCGCGCCATCGGCCTCCTCCGCGGGGCCATGGAGGAACTCATCGGCGCGACCCGACCAGACTGCCTCGTCGCCGACCTGAACTTCTCGTGGGCC
GTCGAGTCCACGGTGCGGTTCGGAATCCCGGCAGTGTTCTTCCACGGGACGGGATACTTCCCGCCTGCGTGCTGGAGTGCATCCGGAACCACAAGCCGTA
CCAAAACGTCTCGTCGGATTCGGATCCGTTGGTGGTTCCAGGCCTGTCGGGTAGAATCGAGTTCACCCGGAACCAGCTGCAGGAGTCGGCGGTGAAGGAG
AAAGCTGAAAGGGGCAGAGGAGCGGCGGATCTCGATTCCTGCCTGGAGTAG
AA sequence
>Lus10027880 pacid=23156976 polypeptide=Lus10027880 locus=Lus10027880.g ID=Lus10027880.BGIv1.0 annot-version=v1.0
MDTTDPSRKLHIIFLPFMTYGHMIPMIDIAKLFAAQGVKSTVVTTPLNAHLFSNQKQNLLRRRSPAHPVPRRGSWAAGVIGVRRLHLLQRKAAGSGFRRQ
ISPRHRPPPRGHGGTHRRDPTRLPRRRPELLVGRRVHGAVRNPGSVLPRDGILPACVLECIRNHKPYQNVSSDSDPLVVPGLSGRIEFTRNQLQESAVKE
KAERGRGAADLDSCLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34135 UGT73B2 UDP-glucosyltransferase 73B2 (... Lus10027880 0 1
AT4G27890 HSP20-like chaperones superfam... Lus10027048 2.2 0.8358
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10034687 2.4 0.8146
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10037147 6.8 0.8180
AT2G17230 EXL5 EXORDIUM like 5 (.1) Lus10026548 10.7 0.7975
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10036779 12.3 0.8029
AT4G05160 AMP-dependent synthetase and l... Lus10027377 12.4 0.7744
AT3G12350 F-box family protein (.1.2) Lus10010606 13.3 0.7320
AT1G03390 HXXXD-type acyl-transferase fa... Lus10033079 19.7 0.7815
AT5G27270 EMB976 EMBRYO DEFECTIVE 976, Tetratri... Lus10015739 23.0 0.8028
AT3G54810 GATA GATA8, BME3, BM... GATA TRANSCRIPTION FACTOR 8, B... Lus10009227 24.9 0.7653

Lus10027880 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.