Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51010 78 / 7e-20 Rubredoxin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016735 [exp] 98 / 2e-27 AT5G51010 189 / 3e-62 Rubredoxin-like superfamily protein (.1) Lus10022430 [exp] 94 / 5e-26 AT5G51010 190 / 8e-63 Rubredoxin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G108100 [exp] 78 / 2e-19 AT5G51010 160 / 5e-51 Rubredoxin-like superfamily protein (.1) Potri.012G109700 [exp] 67 / 1e-15 AT5G51010 0 / 1 Rubredoxin-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027889 pacid=23157077 polypeptide=Lus10027889 locus=Lus10027889.g ID=Lus10027889.BGIv1.0 annot-version=v1.0 ATGGTTGTTGCAGTTTGTGGTGCATCCAAGAGAAGATTCAGAGCTTACACTCCATCAGTCACCAAGAATGGCAATGAGAAGGATGTTAGGAAAGCACGCA AAGCTGAACTACAGAGAGACGAAGCTATTGGGCGAGCTTTGCCAATTGCTCTAGTGGTTGGAATTGCCATCCTCGCTGCAATATACTTCTATCTCAACAC TACTTTTTTTTCCATGAGCAACCATCTCATTGTTTCTTACCCTTGTGTGGATGCCAAATATTCTGCAAGCTTCTAA
AA sequence Show only first row Show all	>Lus10027889 pacid=23157077 polypeptide=Lus10027889 locus=Lus10027889.g ID=Lus10027889.BGIv1.0 annot-version=v1.0 MVVAVCGASKRRFRAYTPSVTKNGNEKDVRKARKAELQRDEAIGRALPIALVVGIAILAAIYFYLNTTFFSMSNHLIVSYPCVDAKYSASF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51010			Rubredoxin-like superfamily pr...		Lus10027889 [exp]	0	1
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	1.7	0.8768
AT1G26930			Galactose oxidase/kelch repeat...		Lus10024239 [exp]	3.5	0.8632
AT4G34180			Cyclase family protein (.1)		Lus10031454 [exp]	7.1	0.7915
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	8.2	0.8160
AT3G56550			Pentatricopeptide repeat (PPR)...		Lus10000020 [exp]	8.5	0.7843
AT5G01910			unknown protein		Lus10035364 [exp]	13.7	0.7658
AT5G57170			Tautomerase/MIF superfamily pr...		Lus10033324 [exp]	14.4	0.8234
AT3G48200			unknown protein		Lus10008827 [exp]	16.9	0.8089
AT5G66550			Maf-like protein (.1)		Lus10040204 [exp]	17.2	0.7887
AT3G18440		ATALMT9	aluminum-activated malate tran...		Lus10041471 [exp]	19.7	0.7529

Compare expression of checked genes

Lus10027889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.