Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002393 [exp] 120 / 2e-33 AT5G67360 450 / 9e-148 Subtilase family protein (.1) Lus10000380 [exp] 96 / 3e-28 ND / Lus10027891 [exp] 103 / 1e-27 AT5G67360 531 / 3e-178 Subtilase family protein (.1) Lus10002392 [exp] 93 / 6e-24 AT5G67360 530 / 3e-178 Subtilase family protein (.1) Lus10002396 [exp] 73 / 8e-19 ND 34 / 0.006 Lus10018721 [exp] 44 / 1e-06 AT5G67360 531 / 7e-179 Subtilase family protein (.1) Lus10024814 [exp] 43 / 2e-06 AT3G14240 504 / 3e-169 Subtilase family protein (.1) Lus10001130 [exp] 37 / 0.0004 AT5G67090 581 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10042644 [exp] 37 / 0.0005 AT5G67090 413 / 5e-136 Subtilisin-like serine endopeptidase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100500 [exp] 89 / 1e-22 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1) Potri.002G124500 [exp] 49 / 1e-08 AT5G67090 577 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.014G026500 [exp] 45 / 6e-07 AT5G67090 604 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.014G026700 [exp] 42 / 6e-06 AT5G67090 582 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.006G001600 [exp] 42 / 7e-06 AT5G59810 970 / 0.0 Subtilase family protein (.1) Potri.001G468900 [exp] 40 / 4e-05 AT5G59810 730 / 0.0 Subtilase family protein (.1) Potri.007G045100 [exp] 38 / 0.0002 AT5G67090 727 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027893 pacid=23156932 polypeptide=Lus10027893 locus=Lus10027893.g ID=Lus10027893.BGIv1.0 annot-version=v1.0 ATGAAGGCTGTTGTGGAGCCTTCTGTGATAATGTTTGAAGGGAGGTATCGTACTGCTGCGTTTAACTTGACTGTGGATGTCGTTTTGGATGGGAGTAACA GTGGTTACATTGGGAATTATGGGTTCTTGAGTTGGGTTGAGGTGAATGGGGCGCATGTTGTTAGGAGTCCAATTGTCTCTGCAATTGCATCTCCTAGAAC CTGA
AA sequence Show only first row Show all	>Lus10027893 pacid=23156932 polypeptide=Lus10027893 locus=Lus10027893.g ID=Lus10027893.BGIv1.0 annot-version=v1.0 MKAVVEPSVIMFEGRYRTAAFNLTVDVVLDGSNSGYIGNYGFLSWVEVNGAHVVRSPIVSAIASPRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027893 [exp]	0	1
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10021864 [exp]	1.0	0.9724
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002393 [exp]	1.7	0.9298
AT4G33030		SQD1	sulfoquinovosyldiacylglycerol ...		Lus10032973 [exp]	2.0	0.9373
AT2G37890			Mitochondrial substrate carrie...		Lus10016522 [exp]	3.9	0.8805
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10027895 [exp]	4.2	0.8977
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Lus10009408 [exp]	5.9	0.8362
					Lus10031019 [exp]	6.5	0.8246
AT5G10530			Concanavalin A-like lectin pro...		Lus10020447 [exp]	7.0	0.9073
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032621 [exp]	7.5	0.9244
AT4G05440		EDA35	embryo sac development arrest ...		Lus10000812 [exp]	8.2	0.8734

Compare expression of checked genes

Lus10027893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.