Lus10027896 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67090 56 / 8e-10 Subtilisin-like serine endopeptidase family protein (.1)
AT5G67360 56 / 9e-10 ARA12 Subtilase family protein (.1)
AT1G01900 48 / 4e-07 SBTI1.1, ATSBT1.1 subtilase family protein (.1)
AT1G30600 44 / 7e-06 Subtilase family protein (.1)
AT4G34980 44 / 1e-05 SLP2 subtilisin-like serine protease 2 (.1)
AT3G14240 44 / 2e-05 Subtilase family protein (.1)
AT5G51750 43 / 2e-05 ATSBT1.3 subtilase 1.3 (.1)
AT2G19170 42 / 4e-05 SLP3 subtilisin-like serine protease 3 (.1)
AT5G59120 42 / 4e-05 ATSBT4.13 subtilase 4.13 (.1)
AT4G10550 41 / 8e-05 Subtilase family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002393 118 / 1e-31 AT5G67360 450 / 9e-148 Subtilase family protein (.1)
Lus10002044 99 / 1e-27 AT5G67090 74 / 2e-16 Subtilisin-like serine endopeptidase family protein (.1)
Lus10002398 95 / 4e-25 AT5G67360 66 / 3e-20 Subtilase family protein (.1)
Lus10013154 61 / 1e-11 AT3G14067 915 / 0.0 Subtilase family protein (.1)
Lus10009365 59 / 6e-11 AT5G67090 637 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Lus10018721 58 / 2e-10 AT5G67360 531 / 7e-179 Subtilase family protein (.1)
Lus10024814 56 / 1e-09 AT3G14240 504 / 3e-169 Subtilase family protein (.1)
Lus10001130 54 / 3e-09 AT5G67090 581 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Lus10007036 54 / 4e-09 AT5G67360 564 / 0.0 Subtilase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G100500 99 / 4e-25 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1)
Potri.014G026600 66 / 2e-13 AT5G67360 546 / 0.0 Subtilase family protein (.1)
Potri.003G067000 57 / 3e-10 AT3G14067 969 / 0.0 Subtilase family protein (.1)
Potri.014G018900 56 / 5e-10 AT5G67360 994 / 0.0 Subtilase family protein (.1)
Potri.005G145300 55 / 1e-09 AT5G67360 932 / 0.0 Subtilase family protein (.1)
Potri.002G120400 55 / 2e-09 AT5G67360 966 / 0.0 Subtilase family protein (.1)
Potri.001G167300 54 / 3e-09 AT3G14067 978 / 0.0 Subtilase family protein (.1)
Potri.007G045100 54 / 4e-09 AT5G67090 727 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Potri.003G118800 54 / 4e-09 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1)
Potri.001G455800 54 / 5e-09 AT4G10550 558 / 0.0 Subtilase family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0570 PPP-I PF05922 Inhibitor_I9 Peptidase inhibitor I9
Representative CDS sequence
>Lus10027896 pacid=23157084 polypeptide=Lus10027896 locus=Lus10027896.g ID=Lus10027896.BGIv1.0 annot-version=v1.0
ATGGTTTCCTCTAAGCTTCACACTGTCTTCCTTCTCCTCTCATTAGCCTGTCTTCCTTCTCGTCTCATTAGCCACATCGCTCTCCACGTCATCCGACCGT
GGGACCTACATCGTCCACATGGACAAATCAGCCATCCCAAACCCCTTCGCGACTCCATGCATTGGTACACGTTGATTCTCTCGCCCATGTCATCAGAACC
TCTCCATCTCTACACCTACAAGCATGTAATCAACGGATTCAGCGCTGTCCTCACACAAGCTCTGCTCGATCAAGTAGAGCAGATCCCCGGCCACGTGGCG
ACCTTCCCCGAATCCTACAGCCATCGTCACACGACCTATACTCCGAAATTCCTCGGCCTGAACAAACTTGCCTATGGCCAGCTGGCAAGTTTGGTGGCGA
TGACGTAA
AA sequence
>Lus10027896 pacid=23157084 polypeptide=Lus10027896 locus=Lus10027896.g ID=Lus10027896.BGIv1.0 annot-version=v1.0
MVSSKLHTVFLLLSLACLPSRLISHIALHVIRPWDLHRPHGQISHPKPLRDSMHWYTLILSPMSSEPLHLYTYKHVINGFSAVLTQALLDQVEQIPGHVA
TFPESYSHRHTTYTPKFLGLNKLAYGQLASLVAMT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027896 0 1
AT1G14185 Glucose-methanol-choline (GMC)... Lus10030458 1.0 0.9990
AT5G12060 Plant self-incompatibility pro... Lus10023085 5.3 0.8238
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693 6.5 0.8238
AT5G18460 Protein of Unknown Function (D... Lus10006861 7.5 0.8238
AT2G17030 F-box family protein with a do... Lus10022619 8.4 0.8158
AT2G39730 RCA rubisco activase (.1.2.3) Lus10035616 9.2 0.8131
AT1G61290 ATSYP124, SYP12... syntaxin of plants 124 (.1) Lus10018441 9.4 0.7677
Lus10011218 9.9 0.8095
AT5G03620 Subtilisin-like serine endopep... Lus10003254 11.8 0.7658
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001037 12.4 0.7673

Lus10027896 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.