Lus10027915 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012067 100 / 4e-28 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027915 pacid=23157006 polypeptide=Lus10027915 locus=Lus10027915.g ID=Lus10027915.BGIv1.0 annot-version=v1.0
ATGGTGGGTCGTCGATGTGTTACGATGATGATAAGTCTGGTTCTGTTTGTAGCCTTATCGTCTCAGATTGTAATGTCGTCTCATCAACAGGCTACGCATT
ATTTTCAGAATCCTGATGATCAGAAGACTGTAGAAGAAATTTATGAAAAGAAGCGTGAAGAAGAGTTGAAACAAATGAAGATTACTGCACGGCCAAGTAT
ATCAAGTCCAGCTCGTCATGCCTCCCCTCCTCCTCCTCGTCCTCTTGGTCCTCCGCCTCCTTCTCCGCCGCTGCCGCCACCGCCAGCTGGTCGTTTCTAT
CCGCCTTCACCTCCGCCGTGTACTTTTCATCCGCCTCCACCTCCCAAGTCGTCACACAAATTCTAG
AA sequence
>Lus10027915 pacid=23157006 polypeptide=Lus10027915 locus=Lus10027915.g ID=Lus10027915.BGIv1.0 annot-version=v1.0
MVGRRCVTMMISLVLFVALSSQIVMSSHQQATHYFQNPDDQKTVEEIYEKKREEELKQMKITARPSISSPARHASPPPPRPLGPPPPSPPLPPPPAGRFY
PPSPPPCTFHPPPPPKSSHKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027915 0 1
Lus10031841 1.4 0.9865
AT5G24318 O-Glycosyl hydrolases family 1... Lus10021088 4.9 0.9658
AT2G23770 protein kinase family protein ... Lus10019661 5.3 0.9692
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10024511 7.5 0.9594
AT1G76680 OPR1, ATOPR1 ARABIDOPSIS 12-OXOPHYTODIENOAT... Lus10001275 8.4 0.9566
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013332 8.8 0.9542
Lus10027376 9.6 0.9671
AT4G38260 Protein of unknown function (D... Lus10016024 10.4 0.9457
AT1G17860 Kunitz family trypsin and prot... Lus10011090 10.8 0.9574
AT3G26040 HXXXD-type acyl-transferase fa... Lus10019183 11.7 0.9518

Lus10027915 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.