Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027917 pacid=23156891 polypeptide=Lus10027917 locus=Lus10027917.g ID=Lus10027917.BGIv1.0 annot-version=v1.0 ATGGCCGTTCAAACACCTACGCATCATCACCTTCTTCTTAAGCCTGATGATCAGAAGATGATGGAAGACGAGATTTATGAAAAGAAGCGTGAAGAAGAGT TGAAACAAATGAAGATCACTGCACGGCCAAGTATATCAAGTCCAGCCCGTCATGCCTCCCCTCCGCCTCGTCCTCTTGGTCCTCCGCCTCCTTCTCCGCC GCCACCGCCGCCGCCGGCCGGTCGTTTCTATCCACCGCGGGCCGGTCGTTTCTATCCGCCTCCACCTCCCAAGTCACAAAAATTCTAA
AA sequence Show only first row Show all	>Lus10027917 pacid=23156891 polypeptide=Lus10027917 locus=Lus10027917.g ID=Lus10027917.BGIv1.0 annot-version=v1.0 MAVQTPTHHHLLLKPDDQKMMEDEIYEKKREEELKQMKITARPSISSPARHASPPPRPLGPPPPSPPPPPPPAGRFYPPRAGRFYPPPPPKSQKF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027917 [exp]	0	1
AT4G19380			Long-chain fatty alcohol dehyd...		Lus10035673 [exp]	2.4	0.9214
					Lus10036436 [exp]	2.4	0.9350
AT3G53810			Concanavalin A-like lectin pro...		Lus10004980 [exp]	4.6	0.9015
AT4G17486			PPPDE putative thiol peptidase...		Lus10043293 [exp]	7.3	0.8361
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10030904 [exp]	11.5	0.8722
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10027120 [exp]	11.8	0.8451
AT4G09960	MADS	AGL11, STK	SEEDSTICK, AGAMOUS-like 11, K-...		Lus10009481 [exp]	13.2	0.8804
AT1G62660			Glycosyl hydrolases family 32 ...		Lus10032242 [exp]	13.5	0.8197
AT1G63830			PLAC8 family protein (.1.2.3)		Lus10028774 [exp]	16.1	0.7802
AT1G52800			2-oxoglutarate (2OG) and Fe(II...		Lus10013132 [exp]	16.6	0.8560

Compare expression of checked genes

Lus10027917 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.