Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77940 159 / 2e-52 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT3G18740 158 / 7e-52 RLK902 receptor-like kinase 902, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT1G36240 157 / 8e-52 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016432 [exp] 172 / 1e-57 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10016431 [exp] 172 / 1e-57 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10012057 [exp] 171 / 5e-57 AT1G77940 145 / 2e-46 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019682 [exp] 171 / 6e-57 AT1G36240 199 / 1e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019681 [exp] 170 / 1e-56 AT1G36240 201 / 2e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G196500 [exp] 173 / 8e-58 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.009G158700 [exp] 173 / 8e-58 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.007G086800 [exp] 170 / 1e-56 AT1G77940 207 / 6e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.005G080700 [exp] 168 / 6e-56 AT1G77940 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [flax] [poplar] PELOTA PF01248 [flax] [poplar] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Lus10027926 pacid=23156995 polypeptide=Lus10027926 locus=Lus10027926.g ID=Lus10027926.BGIv1.0 annot-version=v1.0 ATGAAGAGTGGCAAGTACTCTCTCGGCTACAAGACCGTCCTCAAGACCTTGAGGAACTCCAAAGGTAAGTTGGTGATCATTGCCAACAACTGCCCACCTC TTAGGAAGTCTGAGATTGAATACTATGCTATGCTGTCCAAGGTTGGAGTTCATCACTACAGTGGCAACAATGTAGAACTGGGAACGGCCTGTGGTAAATA CTTCAGAGTCTGCTGCCTCAGCATTATCGATGCAGGTGATTCTGATATCATTAAGAACATGCCAAGCGATCACTAA
AA sequence Show only first row Show all	>Lus10027926 pacid=23156995 polypeptide=Lus10027926 locus=Lus10027926.g ID=Lus10027926.BGIv1.0 annot-version=v1.0 MKSGKYSLGYKTVLKTLRNSKGKLVIIANNCPPLRKSEIEYYAMLSKVGVHHYSGNNVELGTACGKYFRVCCLSIIDAGDSDIIKNMPSDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10027926 [exp]	0	1
AT1G41880			Ribosomal protein L35Ae family...		Lus10040235 [exp]	1.4	0.9217
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031002 [exp]	2.4	0.8809
AT1G26880			Ribosomal protein L34e superfa...		Lus10036750 [exp]	3.7	0.9026
AT3G22660			rRNA processing protein-relate...		Lus10031120 [exp]	4.9	0.8717
AT2G18400			ribosomal protein L6 family pr...		Lus10026015 [exp]	5.9	0.8627
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10038910 [exp]	6.3	0.8488
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	6.7	0.8493
AT3G45030			Ribosomal protein S10p/S20e fa...		Lus10031126 [exp]	7.9	0.8330
AT2G09990			Ribosomal protein S5 domain 2-...		Lus10009252 [exp]	8.0	0.8157
AT3G10950			Zinc-binding ribosomal protein...		Lus10006414 [exp]	8.5	0.8547

Compare expression of checked genes

Lus10027926 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.