Plant FIBer expression Database

Lus10027932 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03560 188 / 6e-61 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012049
[exp]
251 / 8e-86 AT5G03560 242 / 9e-81 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G096900
[exp]
209 / 3e-69 AT5G03560 268 / 3e-91 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09350 DUF1992 Domain of unknown function (DUF1992)
Representative CDS sequence
>Lus10027932 pacid=23157019 polypeptide=Lus10027932 locus=Lus10027932.g ID=Lus10027932.BGIv1.0 annot-version=v1.0
ATGGCTGAAGAAACAGAGAAAGAGCTGTCGTGGTCTGTAGCGTTTGTGGATTGCTTCCGTCTGTCGACAGTGATCGAAGCAGTCAACGCCCGGAAGCTCC
CTCCTGAACTCCGCGGCCAGCGCAACTCCGTCGGGTCAGAAACGGACATTATCAATGTGGTTGAGCAACGAATATGGCATTCAATGGAAGAAGGGCAATT
CGAGAACTTGCCGGGGAAAGGGAAGCCTCTGAACCTCGACACGAATCCCCACGCTGACCCGGCCGTAGACACGCTGTACAGGATCCTCTCCAAGAACAAC
TGCGCCCCGGAGTGGGCTGAGCTGAACAAGGAGATCAGGAGCCAGATTTTGGAGTGGCAGACCGGGTTGAAGAAAGCATTCGCGGCTAACAAATGCAACG
GTGGTGAAGTGTCTGAAGCCTTGAAAACTCAGTTGAAAAGCATCAATAATCAAGGCTTGCGACTGATTCTTCTATACAGAAGATGA
AA sequence
>Lus10027932 pacid=23157019 polypeptide=Lus10027932 locus=Lus10027932.g ID=Lus10027932.BGIv1.0 annot-version=v1.0
MAEETEKELSWSVAFVDCFRLSTVIEAVNARKLPPELRGQRNSVGSETDIINVVEQRIWHSMEEGQFENLPGKGKPLNLDTNPHADPAVDTLYRILSKNN
CAPEWAELNKEIRSQILEWQTGLKKAFAANKCNGGEVSEALKTQLKSINNQGLRLILLYRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03560 Tetratricopeptide repeat (TPR)... Lus10027932
[exp]
0 1
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10034468
[exp]
2.0 0.9492
AT1G08110 lactoylglutathione lyase famil... Lus10016138
[exp]
6.3 0.9390
AT4G24740 AME1, AFC2 FUS3-complementing gene 2 (.1.... Lus10043309
[exp]
6.9 0.9378
AT4G26100 CKL1, CK1 casein kinase 1 (.1) Lus10021580
[exp]
6.9 0.9231
AT1G02860 BAH1, NLA nitrogen limitation adaptation... Lus10030375
[exp]
7.5 0.9371
Lus10021689
[exp]
7.7 0.9315
AT2G32230 PRORP1 proteinaceous RNase P 1 (.1) Lus10014928
[exp]
10.4 0.9221
AT2G43210 Ubiquitin-like superfamily pro... Lus10026718
[exp]
11.0 0.9089
AT2G32090 Lactoylglutathione lyase / gly... Lus10010552
[exp]
14.1 0.9150
AT3G04970 DHHC-type zinc finger family p... Lus10033823
[exp]
14.5 0.9314

Lus10027932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.