Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01710 89 / 1e-24 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) AT5G65274 88 / 3e-24 ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028192 [exp] 113 / 3e-34 AT4G01710 236 / 5e-82 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10012040 [exp] 112 / 1e-32 AT4G01710 92 / 2e-23 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10042895 [exp] 110 / 3e-32 AT4G01710 224 / 9e-76 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G136500 [exp] 91 / 4e-25 AT4G01710 224 / 4e-77 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Potri.014G045200 [exp] 76 / 3e-19 AT4G01710 208 / 9e-71 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04699 [flax] [poplar] P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Representative CDS sequence Show only first row Show all	>Lus10027941 pacid=23156931 polypeptide=Lus10027941 locus=Lus10027941.g ID=Lus10027941.BGIv1.0 annot-version=v1.0 ATGGCCGGTGCTGACGGATTTGTGGGATCAGAGAACGCCGAGGCAATCATTACCAGAATCGAACACAAGTCTCGCAAGATTGAGAGCTTACTCAAACAGT ACAAGCCAGTGGAAGCGCTCAAGACAACGCTTGAAGGATCGCCTCCGAAGACCGGCGATGAGCGATGCAAGCATAGAAAGTTTGTTCTCTTCTACTTTTA CGAGCTGTAG
AA sequence Show only first row Show all	>Lus10027941 pacid=23156931 polypeptide=Lus10027941 locus=Lus10027941.g ID=Lus10027941.BGIv1.0 annot-version=v1.0 MAGADGFVGSENAEAIITRIEHKSRKIESLLKQYKPVEALKTTLEGSPPKTGDERCKHRKFVLFYFYEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10027941 [exp]	0	1
AT1G54390		ING2	INHIBITOR OF GROWTH 2, PHD fin...		Lus10018974 [exp]	43.3	0.4422
AT3G23600			alpha/beta-Hydrolases superfam...		Lus10000668 [exp]	47.7	0.5162
AT2G34930			disease resistance family prot...		Lus10001034 [exp]	73.7	0.4682
					Lus10022247 [exp]	84.1	0.4749
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10009746 [exp]	105.9	0.4574
AT3G03470		CYP89A9	"cytochrome P450, family 87, s...		Lus10020354 [exp]	131.5	0.4188
AT2G34930			disease resistance family prot...		Lus10002753 [exp]	140.6	0.4360
					Lus10023538 [exp]	245.5	0.4007

Compare expression of checked genes

Lus10027941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.