Lus10027947 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 82 / 3e-19 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G17140 52 / 7e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G64620 39 / 0.0008 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000822 219 / 1e-73 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 118 / 8e-34 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 109 / 3e-30 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017013 103 / 5e-28 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017076 101 / 4e-27 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037792 99 / 3e-26 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017040 94 / 4e-24 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 84 / 3e-20 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 59 / 5e-11 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G063000 100 / 2e-26 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.009G083500 84 / 2e-20 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G102600 68 / 2e-14 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.016G001600 47 / 1e-06 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.006G134900 42 / 5e-05 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G288500 39 / 0.0002 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.007G108301 39 / 0.0005 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10027947 pacid=23181196 polypeptide=Lus10027947 locus=Lus10027947.g ID=Lus10027947.BGIv1.0 annot-version=v1.0
ATGGCGCCACACCCAACACAACTCACCGGCGCTCTGACCTCCGCCGCCCTCTTTCTCCTCATCATAACAACCACCACCACCCATGCCTCCTCCTCCGTCG
TAGCCGCCGCCAGCAATCTCATCACACAAACATGCAAGCAAACCCCAGACTACAACCTCTGCGTATCCTCCCTCACCGCCGACACCCGCGGCCCGAAAGC
AAATGACGTCCAGACCCTCGCCCTCATAATGATAGACGTAGTCAGCAACAAGGCCGCCGCAACTTCCGAGGAAATCCAGCGGCTGCTTAAAGGCAATCCG
ACGTTGAAGGAGCCGCTGATGAAATGCGCCGACAAGTATAAGGCCGTCGTCGATGTTGACGTCAGCGTGGCGATCAAGGCGGTTCGTGTAGGGAACCCGG
GTGCCGGAGAAGGAGCGATGAACGACGCTGGAAACAAGTCCGATTCGTGCGAGCGTGGATTTCAAGGAGCGAAGTCGCCGTTGACTGACATGAATAACGC
TGTACGTAACGTTGCTGATGTGGCGTCCTCTATTATTAGCCTGTTGATTTGA
AA sequence
>Lus10027947 pacid=23181196 polypeptide=Lus10027947 locus=Lus10027947.g ID=Lus10027947.BGIv1.0 annot-version=v1.0
MAPHPTQLTGALTSAALFLLIITTTTTHASSSVVAAASNLITQTCKQTPDYNLCVSSLTADTRGPKANDVQTLALIMIDVVSNKAAATSEEIQRLLKGNP
TLKEPLMKCADKYKAVVDVDVSVAIKAVRVGNPGAGEGAMNDAGNKSDSCERGFQGAKSPLTDMNNAVRNVADVASSIISLLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10027947 0 1
AT2G31083 AtCLE5, CLE5, C... CLAVATA3/ESR-RELATED 5 (.1) Lus10002196 2.8 0.7606
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001037 3.6 0.8111
AT3G19300 Protein kinase superfamily pro... Lus10034770 5.5 0.7589
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693 5.8 0.7827
AT2G03630 unknown protein Lus10026665 6.9 0.7291
AT5G18460 Protein of Unknown Function (D... Lus10006861 7.1 0.7827
AT5G12060 Plant self-incompatibility pro... Lus10023085 8.2 0.7827
Lus10011218 9.7 0.7785
AT2G17030 F-box family protein with a do... Lus10022619 11.0 0.7742
AT5G44410 FAD-binding Berberine family p... Lus10042383 11.4 0.6380

Lus10027947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.