Lus10027955 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05440 112 / 6e-31 EDA35 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027954 190 / 3e-61 AT4G05440 419 / 1e-147 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Lus10000812 170 / 4e-56 AT4G05440 133 / 7e-39 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Lus10006898 170 / 1e-53 AT4G05440 418 / 4e-147 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G112300 136 / 2e-40 AT4G05440 390 / 3e-136 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Potri.017G048600 129 / 2e-37 AT4G05440 404 / 6e-141 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0179 ATP-grasp PF07065 D123 D123
Representative CDS sequence
>Lus10027955 pacid=23181187 polypeptide=Lus10027955 locus=Lus10027955.g ID=Lus10027955.BGIv1.0 annot-version=v1.0
ATGTTGCAGTTCGAATCAGAGAATTACACATTTGATGTCTATGTCACCAACGACGGCCGTGTTAAGATTTTGGATTTTAACCCTTGGGGTGCATTTACAC
TGCCACTGCTATTTACGTGGGAGGAACTCGAGCAAGTTACAGGGGAAGGGCTAGATGATGATGATGGTGTGGAGTTGAGAGTTGTGGAGACTCGGTGTGG
AATTCGGCCCGGGTTGAAAACAGCAGTTCCACAGGAGTTCCTGGATGTTGGCCCAGGGAGTGGATGGGAGCAGGTCTTGAAGAACGCATTTGAGGAGCAG
CAGCAGAACGCACAAGTATCGGACGATGTTTGA
AA sequence
>Lus10027955 pacid=23181187 polypeptide=Lus10027955 locus=Lus10027955.g ID=Lus10027955.BGIv1.0 annot-version=v1.0
MLQFESENYTFDVYVTNDGRVKILDFNPWGAFTLPLLFTWEELEQVTGEGLDDDDGVELRVVETRCGIRPGLKTAVPQEFLDVGPGSGWEQVLKNAFEEQ
QQNAQVSDDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G05440 EDA35 embryo sac development arrest ... Lus10027955 0 1
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Lus10013287 2.4 0.9448
AT2G37480 unknown protein Lus10023755 2.8 0.9309
AT3G15352 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROM... Lus10037356 3.6 0.9136
AT3G18620 DHHC-type zinc finger family p... Lus10040971 4.6 0.9241
AT5G61830 NAD(P)-binding Rossmann-fold s... Lus10032525 6.0 0.9277
AT5G46840 RNA-binding (RRM/RBD/RNP motif... Lus10004563 6.0 0.9213
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Lus10030810 7.2 0.9337
AT1G27450 APRT, ATAPT1, A... ARABIDOPSIS THALIANA ADENINE P... Lus10007757 7.4 0.9293
AT1G06640 2-oxoglutarate (2OG) and Fe(II... Lus10009238 7.7 0.8751
AT3G18620 DHHC-type zinc finger family p... Lus10013426 7.9 0.9310

Lus10027955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.