Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04380 225 / 4e-73 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-domain containing protein lysine methyltransferase family protein (.1.2) AT1G04050 178 / 5e-53 SDG13, SUVR1 SET DOMAIN PROTEIN 13, homolog of SU(var)3-9 1 (.1) AT5G43990 170 / 3e-50 SDG18, SUVR2 SET DOMAIN PROTEIN 18, SET-domain containing protein lysine methyltransferase family protein (.1.2.3.4.5) AT2G23740 102 / 4e-26 C2H2ZnF AtCZS nucleic acid binding;sequence-specific DNA binding transcription factors;zinc ion binding (.1.2) AT3G03750 85 / 4e-20 SUVR3, SDG20 SET domain protein 20 (.1.2) AT1G73100 81 / 2e-18 SDG19, SUVH3 SET DOMAIN PROTEIN 19, SU(VAR)3-9 homolog 3 (.1) AT2G22740 73 / 1e-15 SDG23, SUVH6 SET DOMAIN PROTEIN 23, SU(VAR)3-9 homolog 6 (.1), SU(VAR)3-9 homolog 6 (.2) AT5G04940 73 / 1e-15 SUVH1 SU(VAR)3-9 homolog 1 (.1), SU(VAR)3-9 homolog 1 (.2) AT2G35160 72 / 1e-15 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN 9, SU(VAR)3-9 homolog 5 (.1) AT1G17770 65 / 6e-13 SDG17, SUVH7 SET DOMAIN PROTEIN 17, SU(VAR)3-9 homolog 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005476 [exp] 271 / 8e-91 AT3G04380 503 / 3e-176 SET DOMAIN PROTEIN 31, SET-domain containing protein lysine methyltransferase family protein (.1.2) Lus10012513 [exp] 196 / 1e-61 AT3G04380 419 / 2e-143 SET DOMAIN PROTEIN 31, SET-domain containing protein lysine methyltransferase family protein (.1.2) Lus10022657 [exp] 193 / 1e-61 AT3G04380 412 / 2e-142 SET DOMAIN PROTEIN 31, SET-domain containing protein lysine methyltransferase family protein (.1.2) Lus10024946 [exp] 169 / 1e-49 AT5G43990 488 / 7e-163 SET DOMAIN PROTEIN 18, SET-domain containing protein lysine methyltransferase family protein (.1.2.3.4.5) Lus10022879 [exp] 154 / 5e-44 AT5G43990 455 / 2e-149 SET DOMAIN PROTEIN 18, SET-domain containing protein lysine methyltransferase family protein (.1.2.3.4.5) Lus10022483 [exp] 92 / 3e-22 AT2G23740 1070 / 0.0 nucleic acid binding;sequence-specific DNA binding transcription factors;zinc ion binding (.1.2) Lus10016788 [exp] 91 / 6e-22 AT2G23740 1325 / 0.0 nucleic acid binding;sequence-specific DNA binding transcription factors;zinc ion binding (.1.2) Lus10001011 [exp] 84 / 2e-19 AT2G35160 615 / 0.0 SET DOMAIN-CONTAINING PROTEIN 9, SU(VAR)3-9 homolog 5 (.1) Lus10013623 [exp] 83 / 2e-19 AT3G03750 320 / 3e-108 SET domain protein 20 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G048100 [exp] 231 / 1e-73 AT3G04380 471 / 5e-161 SET DOMAIN PROTEIN 31, SET-domain containing protein lysine methyltransferase family protein (.1.2) Potri.002G257400 [exp] 201 / 3e-61 AT5G43990 524 / 8e-176 SET DOMAIN PROTEIN 18, SET-domain containing protein lysine methyltransferase family protein (.1.2.3.4.5) Potri.014G192500 [exp] 197 / 7e-60 AT5G43990 531 / 3e-178 SET DOMAIN PROTEIN 18, SET-domain containing protein lysine methyltransferase family protein (.1.2.3.4.5) Potri.009G138600 [exp] 189 / 4e-58 AT3G04380 427 / 2e-144 SET DOMAIN PROTEIN 31, SET-domain containing protein lysine methyltransferase family protein (.1.2) Potri.005G129800 [exp] 96 / 1e-23 AT2G23740 1468 / 0.0 nucleic acid binding;sequence-specific DNA binding transcription factors;zinc ion binding (.1.2) Potri.007G033000 [exp] 95 / 3e-23 AT2G23740 1436 / 0.0 nucleic acid binding;sequence-specific DNA binding transcription factors;zinc ion binding (.1.2) Potri.013G064600 [exp] 81 / 9e-19 AT3G03750 258 / 1e-83 SET domain protein 20 (.1.2) Potri.003G083100 [exp] 81 / 1e-18 AT2G35160 676 / 0.0 SET DOMAIN-CONTAINING PROTEIN 9, SU(VAR)3-9 homolog 5 (.1) Potri.001G036800 [exp] 76 / 8e-17 AT1G73100 796 / 0.0 SET DOMAIN PROTEIN 19, SU(VAR)3-9 homolog 3 (.1) Potri.003G188700 [exp] 75 / 2e-16 AT1G73100 806 / 0.0 SET DOMAIN PROTEIN 19, SU(VAR)3-9 homolog 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00856 [flax] [poplar] SET SET domain
Representative CDS sequence Show only first row Show all	>Lus10027956 pacid=23181260 polypeptide=Lus10027956 locus=Lus10027956.g ID=Lus10027956.BGIv1.0 annot-version=v1.0 ATGAGCTGTGGAAATCGGGTTCTACAACTGGGTATCACTTGCAAATTACAGGATTTCACGACTCGTGAAGGCAAAGGCTGGGGTCTGAGAGCTCCCCAGA ACTTGCCTAAGGGAGCTTTCGTTTGTGAGTATGCAGGGGAGATATTGACTAACACAGAGCTGCATAAGCGGAATATGCATAGTAAACGCAATGAAAAGCA CACCTATCCCGTTACGCTTGATGCTGACTGGGGTTCAGAAAGAACTATGAATGACGATGAAGCACTTTGTTTAGATGCTACTCACTGTGGAAATGTAGCT AGATTCATTAACCACAGATGTCACGATGGGAACTTAACGAACATTCCTGTCGAAGTGGAGACCCCCGATCGGCACTATTACCATCTTGGTTTATTCACTA AAAGAGAAGTGAAGGCTCATGAGGAGTTGACTTAG
AA sequence Show only first row Show all	>Lus10027956 pacid=23181260 polypeptide=Lus10027956 locus=Lus10027956.g ID=Lus10027956.BGIv1.0 annot-version=v1.0 MSCGNRVLQLGITCKLQDFTTREGKGWGLRAPQNLPKGAFVCEYAGEILTNTELHKRNMHSKRNEKHTYPVTLDADWGSERTMNDDEALCLDATHCGNVA RFINHRCHDGNLTNIPVEVETPDRHYYHLGLFTKREVKAHEELT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Lus10027956 [exp]	0	1

Compare expression of checked genes

Lus10027956 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.