Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G230200 [exp] 52 / 3e-09 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027957 pacid=23181115 polypeptide=Lus10027957 locus=Lus10027957.g ID=Lus10027957.BGIv1.0 annot-version=v1.0 ATGGCGTTGCAGATCAGTGGTATAGCAGGAGGAGTACTGAGTCTGAGGATTCACCAACATAGTAAAAATGGTGTAGCAAGACCATCACTCTCCTTCAGTA CCAGATCCAAATCTACCCACTTCGTCGGATTTCGAAGCAGGATGCGAAATGCAGTCACCCTTGTCATGGCGACACCTTCCGATTCCAATCCTAATACCAC CAGGACTTCTGGAGGAGAGGAGAAAGTGAAGCAGCAGACAATATCAAAGACGACTGGTGTTGGTGGTGAGGGGCCTCCATTGGCCACAATCATAGCAGGG TTTGCGGTGTTCTTTGGAATTTGTTGGGTTCTGTTTACTATTGGGAGTTGGTTGTTCAACCTTATTGTTATACCGCCTCCTCCTAAATAG
AA sequence Show only first row Show all	>Lus10027957 pacid=23181115 polypeptide=Lus10027957 locus=Lus10027957.g ID=Lus10027957.BGIv1.0 annot-version=v1.0 MALQISGIAGGVLSLRIHQHSKNGVARPSLSFSTRSKSTHFVGFRSRMRNAVTLVMATPSDSNPNTTRTSGGEEKVKQQTISKTTGVGGEGPPLATIIAG FAVFFGICWVLFTIGSWLFNLIVIPPPPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027957 [exp]	0	1
AT2G46910			Plastid-lipid associated prote...		Lus10036340 [exp]	3.7	0.8427
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10034583 [exp]	6.5	0.8317
AT3G07568			unknown protein		Lus10016081 [exp]	6.6	0.8013
AT1G79040		PSBR	photosystem II subunit R (.1)		Lus10042461 [exp]	14.5	0.8558
AT3G27160		GHS1	GLUCOSE HYPERSENSITIVE 1, Ribo...		Lus10041564 [exp]	18.0	0.8448
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10009703 [exp]	19.4	0.8292
AT1G15140			FAD/NAD(P)-binding oxidoreduct...		Lus10007955 [exp]	19.8	0.7924
AT1G79040		PSBR	photosystem II subunit R (.1)		Lus10026205 [exp]	22.0	0.8538
AT1G22630			unknown protein		Lus10018614 [exp]	25.5	0.8506
AT3G47590			alpha/beta-Hydrolases superfam...		Lus10012836 [exp]	25.9	0.8023

Compare expression of checked genes

Lus10027957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.