Lus10027964 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18910 163 / 7e-48 Protein kinase superfamily protein (.1)
AT5G35960 161 / 7e-48 Protein kinase family protein (.1)
AT3G05140 157 / 9e-46 RBK2 ROP binding protein kinases 2 (.1)
AT5G65530 144 / 5e-41 Protein kinase superfamily protein (.1)
AT5G10520 140 / 1e-39 RBK1 ROP binding protein kinases 1 (.1)
AT2G18890 133 / 2e-38 Protein kinase superfamily protein (.1.2)
AT5G57670 123 / 8e-33 Protein kinase superfamily protein (.2)
AT1G21590 100 / 2e-24 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT4G35030 97 / 5e-24 Protein kinase superfamily protein (.1.2.3)
AT1G77280 98 / 1e-23 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008192 208 / 1e-65 AT5G35960 489 / 4e-172 Protein kinase family protein (.1)
Lus10025713 168 / 3e-50 AT5G65530 461 / 8e-161 Protein kinase superfamily protein (.1)
Lus10012776 168 / 9e-49 AT5G18910 568 / 0.0 Protein kinase superfamily protein (.1)
Lus10034000 168 / 1e-48 AT5G18910 568 / 0.0 Protein kinase superfamily protein (.1)
Lus10041248 161 / 4e-46 AT5G18860 362 / 5e-117 nucleoside hydrolase 3, inosine-uridine preferring nucleoside hydrolase family protein (.1)
Lus10035949 145 / 3e-41 AT5G65530 521 / 0.0 Protein kinase superfamily protein (.1)
Lus10012727 146 / 7e-41 AT5G65530 457 / 8e-157 Protein kinase superfamily protein (.1)
Lus10018959 137 / 4e-38 AT3G05140 512 / 8e-180 ROP binding protein kinases 2 (.1)
Lus10006957 130 / 9e-37 AT2G18890 459 / 1e-162 Protein kinase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G136300 172 / 6e-52 AT5G35960 556 / 0.0 Protein kinase family protein (.1)
Potri.010G027301 158 / 1e-45 AT5G18910 527 / 0.0 Protein kinase superfamily protein (.1)
Potri.013G028100 149 / 9e-43 AT3G05140 548 / 0.0 ROP binding protein kinases 2 (.1)
Potri.007G011700 140 / 1e-39 AT5G10520 552 / 0.0 ROP binding protein kinases 1 (.1)
Potri.018G091200 129 / 7e-36 AT2G18890 469 / 8e-166 Protein kinase superfamily protein (.1.2)
Potri.006G166600 126 / 8e-35 AT2G18890 463 / 3e-163 Protein kinase superfamily protein (.1.2)
Potri.006G173700 127 / 2e-34 AT5G57670 654 / 0.0 Protein kinase superfamily protein (.2)
Potri.018G096100 124 / 6e-33 AT5G57670 619 / 0.0 Protein kinase superfamily protein (.2)
Potri.005G067000 98 / 8e-24 AT5G63940 690 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.004G175100 97 / 1e-23 AT2G16750 564 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10027964 pacid=23181141 polypeptide=Lus10027964 locus=Lus10027964.g ID=Lus10027964.BGIv1.0 annot-version=v1.0
ATGACGGCGGATTTCTTGTCGGAGCTCGGAATCATGGCTCACGTTAAACACCCAAATACCGCCAAATTGATCGGATACTGCGTCGACGGCGGGATGCATC
TCGTCCTCCAACTCTCTTCCCGTGGCAGTCTAGCTTCTTCCCTCCACGGTTCGAAGGAGTGTTTGAGCTGGGAGGTTAGGTACAAGATTGCAATGGGGAC
CGCAGAAGGGTTAGTGTATCTACATGGAGGATGCCAGAGAAGAATCATCCATAGAGATATCAAAGCTGCCAATATTCTTCTTACAGAAGAATTCGAGCCT
CAGGCAAAGCCATTGCTGAAGAAGAGTGATATAAGGGAGCTAGTAGATCCAGCACTCGGGAATGCTTACGACGCAAGGCAGGTTAACCTTATGCTCGGAG
CGGCTGCTCTTTGCATTCAGAAATCTGCGATTCGGAGGCCGTTCATGCCTCAGGTGGAGCAAGTGTTGAGAGGGAACGTGAGTTGCTTGAAGTCGACGAA
GAAGTGCAAATTGTCATTTTTCAGAAGAGCATTGAGGGAAGAGTTGCTCAAGGCAGAGGAGAACCAACTATCCCAGAGGGCTTCAATTCAACAAGCTTAA
AA sequence
>Lus10027964 pacid=23181141 polypeptide=Lus10027964 locus=Lus10027964.g ID=Lus10027964.BGIv1.0 annot-version=v1.0
MTADFLSELGIMAHVKHPNTAKLIGYCVDGGMHLVLQLSSRGSLASSLHGSKECLSWEVRYKIAMGTAEGLVYLHGGCQRRIIHRDIKAANILLTEEFEP
QAKPLLKKSDIRELVDPALGNAYDARQVNLMLGAAALCIQKSAIRRPFMPQVEQVLRGNVSCLKSTKKCKLSFFRRALREELLKAEENQLSQRASIQQA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G35960 Protein kinase family protein ... Lus10027964 0 1
AT4G30210 AR2, ATR2 P450 reductase 2 (.1.2) Lus10019996 2.4 0.8363
AT4G36990 HSF AT-HSFB1, ATHSF... ARABIDOPSIS THALIANA HEAT SHOC... Lus10018488 4.4 0.8374
AT1G77580 Plant protein of unknown funct... Lus10012712 9.2 0.8047
AT1G65690 Late embryogenesis abundant (L... Lus10033705 17.4 0.7680
AT1G17745 PGDH D-3-phosphoglycerate dehydroge... Lus10037334 19.3 0.7549
AT4G34050 CCoAOMT1 caffeoyl coenzyme A O-methyltr... Lus10014074 20.1 0.8063
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10038178 22.4 0.7831
AT1G20110 RING/FYVE/PHD zinc finger supe... Lus10017277 23.0 0.7747
AT5G47910 ATRBOHD, RBOHD respiratory burst oxidase homo... Lus10032517 24.2 0.7420
AT1G76140 Prolyl oligopeptidase family p... Lus10021235 24.4 0.7857

Lus10027964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.