Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03430 119 / 2e-35 AHP5 histidine-containing phosphotransfer factor 5 (.1) AT3G29350 117 / 2e-34 ATHP1, AHP2 histidine-containing phosphotransmitter 2 (.1.2) AT5G39340 114 / 2e-33 ATHP2, AHP3 ARABIDOPSIS THALIANA HISTIDINE-CONTAINING PHOSPHOTRANSMITTER 2, histidine-containing phosphotransmitter 3 (.1) AT3G21510 89 / 1e-23 ATHP3, AHP1 histidine-containing phosphotransmitter 1 (.1) AT3G16360 83 / 2e-21 AHP4 HPT phosphotransmitter 4 (.1.2) AT4G04402 76 / 2e-18 two-component phosphorelay mediator, putative (.1) AT1G80100 43 / 6e-06 AHP6 histidine phosphotransfer protein 6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000926 [exp] 130 / 1e-39 AT3G21510 181 / 3e-59 histidine-containing phosphotransmitter 1 (.1) Lus10002256 [exp] 114 / 1e-33 AT3G21510 154 / 3e-49 histidine-containing phosphotransmitter 1 (.1) Lus10033999 [exp] 110 / 9e-32 AT3G21510 216 / 3e-73 histidine-containing phosphotransmitter 1 (.1) Lus10012777 [exp] 109 / 2e-31 AT3G21510 216 / 5e-73 histidine-containing phosphotransmitter 1 (.1) Lus10042680 [exp] 97 / 2e-26 AT1G03430 142 / 2e-43 histidine-containing phosphotransfer factor 5 (.1) Lus10035596 [exp] 72 / 4e-17 AT3G16360 103 / 5e-29 HPT phosphotransmitter 4 (.1.2) Lus10003256 [exp] 72 / 8e-17 AT1G03430 105 / 1e-29 histidine-containing phosphotransfer factor 5 (.1) Lus10011487 [exp] 73 / 1e-16 AT1G80100 194 / 6e-64 histidine phosphotransfer protein 6 (.1.2) Lus10023127 [exp] 71 / 2e-16 AT1G80100 178 / 5e-58 histidine phosphotransfer protein 6 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G113500 [exp] 153 / 8e-49 AT1G03430 210 / 1e-70 histidine-containing phosphotransfer factor 5 (.1) Potri.006G098200 [exp] 144 / 3e-45 AT1G03430 207 / 7e-70 histidine-containing phosphotransfer factor 5 (.1) Potri.005G040400 [exp] 122 / 2e-36 AT3G21510 181 / 1e-59 histidine-containing phosphotransmitter 1 (.1) Potri.013G028300 [exp] 121 / 3e-36 AT3G21510 183 / 2e-60 histidine-containing phosphotransmitter 1 (.1) Potri.014G136200 [exp] 115 / 3e-34 AT1G03430 163 / 2e-52 histidine-containing phosphotransfer factor 5 (.1) Potri.010G027100 [exp] 96 / 2e-26 AT3G21510 206 / 5e-69 histidine-containing phosphotransmitter 1 (.1) Potri.008G197600 [exp] 96 / 4e-26 AT3G21510 193 / 3e-64 histidine-containing phosphotransmitter 1 (.1) Potri.001G189900 [exp] 82 / 6e-21 AT3G16360 239 / 1e-82 HPT phosphotransmitter 4 (.1.2) Potri.018G046800 [exp] 76 / 1e-18 AT3G16360 170 / 3e-55 HPT phosphotransmitter 4 (.1.2) Potri.003G032400 [exp] 74 / 9e-18 AT1G80100 204 / 2e-68 histidine phosphotransfer protein 6 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01627 [flax] [poplar] Hpt Hpt domain
Representative CDS sequence Show only first row Show all	>Lus10027965 pacid=23181150 polypeptide=Lus10027965 locus=Lus10027965.g ID=Lus10027965.BGIv1.0 annot-version=v1.0 ATGGCCGTCCTCACTCAGTTGCAGCTCCAGATCGTTGACTACAACAACTCCTTACGTCGAGATGGATTTGTGGACGACCAGTTCTCCCAGCTTCAGAAGC TGCAAGATGAAAGCAGCCCTGAATTCGTGATGGAGGTTGTTTCTCTCTTCTTCGACGATTGTCAGAAGCTTGTTAACAACATGGCCAGAGCTCTTGAACT GCAGGTTGTTGATTTTAAACAAGTAGATTCCCATGTTCACCAATTGATGGGTAGTAGCTCAAGGTGTCTGGTATGCTTACAAGGAGTGAACCGGGAGTAC ACTTTGTTGAAAAACAAGCTCCAGCATTTGTTCATGGTGAGTTCTGAACCATTAAGGATATCTGATGATTAG
AA sequence Show only first row Show all	>Lus10027965 pacid=23181150 polypeptide=Lus10027965 locus=Lus10027965.g ID=Lus10027965.BGIv1.0 annot-version=v1.0 MAVLTQLQLQIVDYNNSLRRDGFVDDQFSQLQKLQDESSPEFVMEVVSLFFDDCQKLVNNMARALELQVVDFKQVDSHVHQLMGSSSRCLVCLQGVNREY TLLKNKLQHLFMVSSEPLRISDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10027965 [exp]	0	1
AT2G35930		PUB23	plant U-box 23 (.1)		Lus10013352 [exp]	13.7	0.8248
AT1G70300		KUP6	K+ uptake permease 6, K+ uptak...		Lus10029173 [exp]	16.6	0.8015
AT1G53530			Peptidase S24/S26A/S26B/S26C f...		Lus10005571 [exp]	20.0	0.7892
					Lus10038768 [exp]	22.4	0.7965
					Lus10041183 [exp]	29.5	0.7657
AT2G30340	AS2	LBD13	LOB domain-containing protein ...		Lus10034208 [exp]	44.6	0.7851
AT3G56930			DHHC-type zinc finger family p...		Lus10010447 [exp]	50.8	0.7674
AT1G61260			Protein of unknown function (D...		Lus10020090 [exp]	51.8	0.7815
AT5G55980			serine-rich protein-related (....		Lus10023227 [exp]	52.8	0.7653
AT1G67420			Zn-dependent exopeptidases sup...		Lus10037015 [exp]	70.0	0.7787

Compare expression of checked genes

Lus10027965 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.