Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03440 161 / 1e-49 Leucine-rich repeat (LRR) family protein (.1) AT4G03010 159 / 5e-49 RNI-like superfamily protein (.1) AT3G17640 69 / 3e-15 Leucine-rich repeat (LRR) family protein (.1) AT2G23950 44 / 2e-06 Leucine-rich repeat protein kinase family protein (.1) AT1G13910 42 / 1e-05 Leucine-rich repeat (LRR) family protein (.1) AT5G61240 41 / 2e-05 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT4G30520 40 / 5e-05 SARK SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE, Leucine-rich repeat protein kinase family protein (.1) AT3G59510 38 / 0.0004 Leucine-rich repeat (LRR) family protein (.1) AT1G50610 37 / 0.0008 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008190 [exp] 197 / 8e-64 AT1G03440 576 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10042681 [exp] 166 / 7e-53 AT4G03010 205 / 1e-63 RNI-like superfamily protein (.1) Lus10029622 [exp] 167 / 5e-52 AT1G03440 534 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10031601 [exp] 151 / 6e-46 AT1G03440 463 / 2e-163 Leucine-rich repeat (LRR) family protein (.1) Lus10037108 [exp] 45 / 1e-06 AT5G61240 550 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10026651 [exp] 43 / 6e-06 AT5G61240 549 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10004662 [exp] 43 / 7e-06 AT5G61240 543 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10036961 [exp] 43 / 8e-06 AT5G61240 488 / 1e-175 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10015484 [exp] 40 / 5e-05 AT2G23950 910 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G136100 [exp] 170 / 4e-53 AT1G03440 541 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Potri.004G001000 [exp] 82 / 1e-19 AT3G17640 386 / 1e-132 Leucine-rich repeat (LRR) family protein (.1) Potri.011G023500 [exp] 80 / 5e-19 AT3G17640 350 / 2e-118 Leucine-rich repeat (LRR) family protein (.1) Potri.008G093400 [exp] 45 / 1e-06 AT5G61240 513 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.010G160700 [exp] 44 / 2e-06 AT5G61240 517 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.018G002600 [exp] 39 / 0.0001 AT3G20190 540 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.007G078100 [exp] 38 / 0.0003 AT4G39400 1426 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1) Potri.005G037400 [exp] 38 / 0.0003 AT3G47570 622 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G086500 [exp] 38 / 0.0003 AT4G39400 1398 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1) Potri.019G078400 [exp] 38 / 0.0005 AT1G72180 1060 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027968 pacid=23181264 polypeptide=Lus10027968 locus=Lus10027968.g ID=Lus10027968.BGIv1.0 annot-version=v1.0 ATGTTCTCCACCGTACAGAATCTGTACCTGAACAATAACCGGTTCAGCGGTGAGGTCCCCGGGAGTCTTGTAGACCGGTTGATGGCGACAGGGATGGAGA CTCTGTATTTACAGCATAACTATCTGACGGGGATCGAGATTAATCCGACGGCGGAGATTCCGGTGAGTAGCGCGCTGTGTTTGCAGTACAATTGCATGGT GCCGCCGGTGCAGACTCCTTGCCCGTTGAAGGCCGGGCAGCAGAAGACTAGGCCGACCGATCAATGCAGAGAATGGAGAGGGTAA
AA sequence Show only first row Show all	>Lus10027968 pacid=23181264 polypeptide=Lus10027968 locus=Lus10027968.g ID=Lus10027968.BGIv1.0 annot-version=v1.0 MFSTVQNLYLNNNRFSGEVPGSLVDRLMATGMETLYLQHNYLTGIEINPTAEIPVSSALCLQYNCMVPPVQTPCPLKAGQQKTRPTDQCREWRG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03440			Leucine-rich repeat (LRR) fami...		Lus10027968 [exp]	0	1
AT3G56370			Leucine-rich repeat protein ki...		Lus10012877 [exp]	4.5	0.8198
AT2G40980			Protein kinase superfamily pro...		Lus10015685 [exp]	6.0	0.8081
AT1G03440			Leucine-rich repeat (LRR) fami...		Lus10008190 [exp]	9.2	0.7909
AT5G66330			Leucine-rich repeat (LRR) fami...		Lus10041809 [exp]	11.0	0.8023
AT5G24020		ARC11, ATMIND1,...	ACCUMULATION AND REPLICATION O...		Lus10038843 [exp]	16.5	0.7784
AT5G48660			B-cell receptor-associated pro...		Lus10011842 [exp]	18.1	0.7766
AT4G29240			Leucine-rich repeat (LRR) fami...		Lus10012929 [exp]	24.6	0.7656
AT5G66330			Leucine-rich repeat (LRR) fami...		Lus10028359 [exp]	28.1	0.7701
AT1G13170		ORP1D	OSBP(oxysterol binding protein...		Lus10006237 [exp]	28.2	0.7561
AT1G69420			DHHC-type zinc finger family p...		Lus10037133 [exp]	29.2	0.7746

Compare expression of checked genes

Lus10027968 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.