Lus10027973 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G48020 49 / 1e-07 Major facilitator superfamily protein (.1.2)
AT3G05150 40 / 0.0002 Major facilitator superfamily protein (.1)
AT1G08900 39 / 0.0003 Major facilitator superfamily protein (.1.2.3)
AT1G08890 38 / 0.001 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008179 77 / 2e-17 AT2G48020 590 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10008184 77 / 4e-17 AT2G48020 593 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10042676 62 / 8e-12 AT2G48020 603 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10027975 0 / 1 AT2G48020 626 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10027976 0 / 1 AT2G48020 598 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10008183 0 / 1 AT2G48020 657 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10008182 0 / 1 AT2G48020 613 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10029629 0 / 1 AT2G48020 661 / 0.0 Major facilitator superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G136600 61 / 1e-11 AT2G48020 665 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.002G212900 57 / 2e-10 AT2G48020 723 / 0.0 Major facilitator superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Lus10027973 pacid=23181107 polypeptide=Lus10027973 locus=Lus10027973.g ID=Lus10027973.BGIv1.0 annot-version=v1.0
ATGCGACCAGGTGCCCAAAGTAAAGCTGGTGGACTTGTTCAACAGAAGATACCTAAGATCAGTCACTGTGAGTCCTCTCTTTCATCTGTTACTGATTTTG
AAGCTCCGTGGTCCTTTGGATTCTCGCCCAGTGTTGGAACCACTACCTACGCCATTCTTCATATCATTGAGACGCTCACCATACCACAAGTGATCGACAG
AGCAGGAAGGAAGCCACTTTTGTTGGTTTCAGGATCTGGTTTGGTGCTGGCCTGCTTGATAATAGGCCTTTCATTCTACCTCAAGCTAATGTCATCCAAG
CACACAACCTGGAGCAGTGGCTGCCAGTGGAGGCTTGACTTGGAGCTTTGTTTTTGTTTTCATGTAATTGGAACTGAACTCATGAACCTCACTGTTGAGG
AGAGGCTATAG
AA sequence
>Lus10027973 pacid=23181107 polypeptide=Lus10027973 locus=Lus10027973.g ID=Lus10027973.BGIv1.0 annot-version=v1.0
MRPGAQSKAGGLVQQKIPKISHCESSLSSVTDFEAPWSFGFSPSVGTTTYAILHIIETLTIPQVIDRAGRKPLLLVSGSGLVLACLIIGLSFYLKLMSSK
HTTWSSGCQWRLDLELCFCFHVIGTELMNLTVEERL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G48020 Major facilitator superfamily ... Lus10027973 0 1
AT1G07270 Cell division control, Cdc6 (.... Lus10000427 4.6 0.8446
AT5G37290 ARM repeat superfamily protein... Lus10008435 7.9 0.8785
AT5G59190 subtilase family protein (.1) Lus10000396 11.2 0.8280
AT4G03115 Mitochondrial substrate carrie... Lus10024769 15.5 0.8661
AT1G73350 unknown protein Lus10031897 28.0 0.8371
AT1G48175 TAD1, EMB2191 tRNA adenosine deaminase 1, em... Lus10009163 35.6 0.8156
Lus10037274 40.3 0.8091
AT1G13440 GAPC2, GAPC-2 GLYCERALDEHYDE-3-PHOSPHATE DEH... Lus10022332 40.5 0.8188
AT3G27670 RST1 RESURRECTION1, ARM repeat supe... Lus10010374 43.5 0.8164
Lus10014678 51.4 0.8194

Lus10027973 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.