Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G48020 49 / 6e-08 Major facilitator superfamily protein (.1.2) AT3G05150 45 / 3e-06 Major facilitator superfamily protein (.1) AT5G18840 40 / 8e-05 Major facilitator superfamily protein (.1) AT1G08920 39 / 0.0003 ESL1 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008182 [exp] 77 / 2e-17 AT2G48020 613 / 0.0 Major facilitator superfamily protein (.1.2) Lus10027975 [exp] 69 / 9e-15 AT2G48020 626 / 0.0 Major facilitator superfamily protein (.1.2) Lus10027976 [exp] 68 / 2e-14 AT2G48020 598 / 0.0 Major facilitator superfamily protein (.1.2) Lus10008183 [exp] 67 / 6e-14 AT2G48020 657 / 0.0 Major facilitator superfamily protein (.1.2) Lus10008184 [exp] 61 / 9e-12 AT2G48020 593 / 0.0 Major facilitator superfamily protein (.1.2) Lus10042676 [exp] 58 / 6e-11 AT2G48020 603 / 0.0 Major facilitator superfamily protein (.1.2) Lus10029629 [exp] 56 / 3e-10 AT2G48020 661 / 0.0 Major facilitator superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G212900 [exp] 46 / 8e-07 AT2G48020 723 / 0.0 Major facilitator superfamily protein (.1.2) Potri.014G136600 [exp] 40 / 8e-05 AT2G48020 665 / 0.0 Major facilitator superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027977 pacid=23181143 polypeptide=Lus10027977 locus=Lus10027977.g ID=Lus10027977.BGIv1.0 annot-version=v1.0 ATGGAGAGCAACAACGCTACTAATGTCACTATCAGAAACAGCAACAACATGAGGGAGCCATTCATCCAGAAGAACGACGAAGAACATGGGTCATCGTCGT CAGAGAAGAAGAAGAAGAAGAATAAGAATGAGAGCTTGTGGATGGTTTACTTCAGCACTTTCGTTGTTGTTTGTGGCTCTTACGAGTTCGGTTGCTGCGC GGGATTCTTTGAAATTGCAGTTGAAGGAGTTCAAAGTTCAGACCGTGTTGTGTTTGCAGTATTGAGTGTTTGGTTCCATTTCGAAATCACCGAGAAACTT TCTGGTCACCGGAGACATAGTTTGACAATTAGAGAAGGTTGA
AA sequence Show only first row Show all	>Lus10027977 pacid=23181143 polypeptide=Lus10027977 locus=Lus10027977.g ID=Lus10027977.BGIv1.0 annot-version=v1.0 MESNNATNVTIRNSNNMREPFIQKNDEEHGSSSSEKKKKKNKNESLWMVYFSTFVVVCGSYEFGCCAGFFEIAVEGVQSSDRVVFAVLSVWFHFEITEKL SGHRRHSLTIREG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G48020			Major facilitator superfamily ...		Lus10027977 [exp]	0	1
					Lus10038209 [exp]	9.5	0.9670
					Lus10001854 [exp]	13.6	0.9635
AT5G12460			Protein of unknown function (D...		Lus10003179 [exp]	16.8	0.9624
					Lus10003763 [exp]	19.4	0.9624
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10016187 [exp]	19.5	0.8551
					Lus10014949 [exp]	19.7	0.9613
AT5G63135			unknown protein		Lus10019491 [exp]	20.6	0.8404
					Lus10034359 [exp]	21.7	0.9624
AT2G41970			Protein kinase superfamily pro...		Lus10016247 [exp]	23.7	0.9624
AT1G47790			F-box and associated interacti...		Lus10042015 [exp]	25.7	0.9624

Compare expression of checked genes

Lus10027977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.