Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02820 65 / 4e-15 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT4G02380 64 / 5e-15 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT3G53770 53 / 3e-10 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2) AT4G15910 52 / 5e-10 ATDI21 drought-induced 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008170 [exp] 107 / 9e-32 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10027987 [exp] 89 / 7e-25 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008169 [exp] 83 / 3e-22 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10029634 [exp] 69 / 1e-16 AT4G02380 57 / 4e-12 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10042672 [exp] 66 / 1e-15 AT4G02380 63 / 2e-14 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10006508 [exp] 48 / 2e-08 AT4G15910 73 / 2e-18 drought-induced 21 (.1) Lus10037497 [exp] 46 / 1e-07 AT4G15910 73 / 5e-18 drought-induced 21 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203500 [exp] 85 / 6e-23 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 78 / 3e-20 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.010G012100 [exp] 46 / 8e-08 AT4G15910 83 / 6e-22 drought-induced 21 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10027986 pacid=23181162 polypeptide=Lus10027986 locus=Lus10027986.g ID=Lus10027986.BGIv1.0 annot-version=v1.0 ATGTCTCGCTCTTTCGCCACCGCCGAGCTTCTCTCTGCCGCCGTCTGCAAGGCAATCCGAAGAAGCAGAGGATTCTCGTCCTCTGCCTCCGCTGCTGCCG CCACAACTGTGAAGGGAGGAGCCGTTTCCGCAGCACGTATTGTGAAGAAAACAGTGGACGAGACGGCTGCTGATAGACAGAGCTGGGTCCCCGACCCGAA GACCGGATTCTACCGACCCGATAACGTTGCCGAGGAGATCGACGCCGCCGAGCTACGCGCTATTCTCCTGAAGAAACACTGA
AA sequence Show only first row Show all	>Lus10027986 pacid=23181162 polypeptide=Lus10027986 locus=Lus10027986.g ID=Lus10027986.BGIv1.0 annot-version=v1.0 MSRSFATAELLSAAVCKAIRRSRGFSSSASAAAATTVKGGAVSAARIVKKTVDETAADRQSWVPDPKTGFYRPDNVAEEIDAAELRAILLKKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02820			Late embryogenesis abundant 3 ...		Lus10027986 [exp]	0	1
AT2G46150			Late embryogenesis abundant (L...		Lus10017531 [exp]	1.4	0.8846
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Lus10032976 [exp]	1.4	0.8947
AT5G43980		PDLP1, PDLP1A	PLASMODESMATA-LOCATED PROTEIN ...		Lus10001052 [exp]	2.4	0.8650
AT4G36830		HOS3-1	GNS1/SUR4 membrane protein fam...		Lus10022493 [exp]	4.2	0.8469
AT3G15510	NAC	ATNAC2, ANAC056...	NAC-REGULATED SEED MORPHOLOGY ...		Lus10043095 [exp]	5.7	0.8225
AT1G64700			unknown protein		Lus10001663 [exp]	6.3	0.8380
AT5G13050		5-FCL	5-formyltetrahydrofolate cyclo...		Lus10010736 [exp]	7.2	0.7869
AT1G52140			unknown protein		Lus10012967 [exp]	7.2	0.8501
AT5G59730		ATEXO70H7	exocyst subunit exo70 family p...		Lus10040872 [exp]	15.0	0.8406
AT3G45230			hydroxyproline-rich glycoprote...		Lus10021479 [exp]	15.0	0.8386

Compare expression of checked genes

Lus10027986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.