Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02820 57 / 3e-12 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT4G02380 55 / 1e-11 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT3G53770 50 / 4e-09 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2) AT4G15910 49 / 4e-09 ATDI21 drought-induced 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008169 [exp] 89 / 6e-25 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10027986 [exp] 76 / 1e-19 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 69 / 5e-17 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10042672 [exp] 54 / 7e-11 AT4G02380 63 / 2e-14 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10029634 [exp] 51 / 7e-10 AT4G02380 57 / 4e-12 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10006508 [exp] 44 / 3e-07 AT4G15910 73 / 2e-18 drought-induced 21 (.1) Lus10037497 [exp] 42 / 4e-06 AT4G15910 73 / 5e-18 drought-induced 21 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203500 [exp] 71 / 9e-18 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 64 / 4e-15 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.010G012100 [exp] 44 / 5e-07 AT4G15910 83 / 6e-22 drought-induced 21 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10027987 pacid=23181197 polypeptide=Lus10027987 locus=Lus10027987.g ID=Lus10027987.BGIv1.0 annot-version=v1.0 ATGTCTCGCACTCTCGCCACCGTCATCAAGGCAATCAGAAGCAGCAGGGGATTCTCATCCTCCTCCGCCGCCGCGGCGCCCGCAACTGTGAAGAAAGTAC CTGTTTCCGCCGCAAAGAAAACAGGGGAGGAGGCGGCCGCGGGTAAACAGAGCTGGATTCCCGACCCGAGAACAGGATTCTACCGACCCGAGCATGTCGC TGAGGAGATCGACGCCGCCGAGCTGCGCGCTCTGCTGTTGAAGAAACACTGA
AA sequence Show only first row Show all	>Lus10027987 pacid=23181197 polypeptide=Lus10027987 locus=Lus10027987.g ID=Lus10027987.BGIv1.0 annot-version=v1.0 MSRTLATVIKAIRSSRGFSSSSAAAAPATVKKVPVSAAKKTGEEAAAGKQSWIPDPRTGFYRPEHVAEEIDAAELRALLLKKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02820			Late embryogenesis abundant 3 ...		Lus10027987 [exp]	0	1
AT5G44710			unknown protein		Lus10038399 [exp]	4.9	0.8773
AT4G21065			Tetratricopeptide repeat (TPR)...		Lus10000117 [exp]	6.0	0.8779
AT1G07130		STN1, ATSTN1	Nucleic acid-binding, OB-fold-...		Lus10042621 [exp]	8.5	0.8615
AT1G67330			Protein of unknown function (D...		Lus10015780 [exp]	12.6	0.8797
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10037212 [exp]	15.8	0.7714
AT1G77490		TAPX	thylakoidal ascorbate peroxida...		Lus10018155 [exp]	21.5	0.8654
AT5G51700		ATRAR1, RPR2, P...	Required for Mla12 resistance ...		Lus10031688 [exp]	22.2	0.8353
AT4G10270			Wound-responsive family protei...		Lus10039752 [exp]	22.9	0.8631
AT2G16770	bZIP	bZIP23	Basic-leucine zipper (bZIP) tr...		Lus10019788 [exp]	23.3	0.8521
AT1G74940			Protein of unknown function (D...		Lus10011923 [exp]	24.8	0.8763

Compare expression of checked genes

Lus10027987 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.