Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59310 53 / 7e-10 LTP4 lipid transfer protein 4 (.1) AT2G38540 52 / 9e-10 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G18370 52 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 51 / 3e-09 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT5G59320 50 / 1e-08 LTP3 lipid transfer protein 3 (.1) AT3G08770 48 / 3e-08 LTP6 lipid transfer protein 6 (.1.2) AT2G38530 48 / 7e-08 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT3G51600 46 / 2e-07 LTP5 lipid transfer protein 5 (.1) AT5G01870 46 / 3e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51590 46 / 4e-07 LTP12 lipid transfer protein 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028002 [exp] 212 / 1e-72 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028055 [exp] 197 / 7e-67 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1) Lus10012383 [exp] 188 / 4e-63 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1) Lus10012384 [exp] 150 / 2e-48 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10007280 [exp] 61 / 7e-13 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10025230 [exp] 59 / 7e-12 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10029226 [exp] 58 / 7e-12 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10025148 [exp] 59 / 8e-12 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10015278 [exp] 57 / 2e-11 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G021900 [exp] 76 / 7e-19 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.016G135700 [exp] 64 / 5e-14 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.001G232700 [exp] 56 / 3e-11 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 56 / 7e-11 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 51 / 4e-09 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G136000 [exp] 50 / 8e-09 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 49 / 2e-08 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G135800 [exp] 49 / 2e-08 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G025200 [exp] 49 / 2e-08 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 47 / 8e-08 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10028003 pacid=23181154 polypeptide=Lus10028003 locus=Lus10028003.g ID=Lus10028003.BGIv1.0 annot-version=v1.0 ATGAAGGGAGTGAACAACATGAATGCCGTTGCATCAGTTTTGATGTTGGCTTTGATCGTTACGGGCTCAACGACTAGCGTAACTGCACAACAACCGGCAA TATGTTCGAGCGCATTGTTGAAGTTGCTACCGTGCTTGACATACATCACAAAGCAAACACCTTCTCCATCTCCTCAGTGCTGCTCAAACGTAAAACTATT GAACGACGAGGCCAGCACCACTCTTATCCGCCAACAGCTATGCACTTGCTTCAAGTCGGCGGCCATTGCCTATCACGTGGATCCACCAGTTGTCAAGGTT CTTCCTGATTTATGCCATGTTAATGTCCCCGTCCCCATCGATCCCACGATCGATTGCAGCAAGTAA
AA sequence Show only first row Show all	>Lus10028003 pacid=23181154 polypeptide=Lus10028003 locus=Lus10028003.g ID=Lus10028003.BGIv1.0 annot-version=v1.0 MKGVNNMNAVASVLMLALIVTGSTTSVTAQQPAICSSALLKLLPCLTYITKQTPSPSPQCCSNVKLLNDEASTTLIRQQLCTCFKSAAIAYHVDPPVVKV LPDLCHVNVPVPIDPTIDCSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028003 [exp]	0	1
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	3.2	0.9197
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	4.5	0.9197
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028002 [exp]	5.3	0.8281
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	5.5	0.9197
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	6.3	0.9169
AT5G50960		ATNBP35, NBP35	nucleotide binding protein 35 ...		Lus10036588 [exp]	6.3	0.7950
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	7.1	0.9151
AT3G44220			Late embryogenesis abundant (L...		Lus10005214 [exp]	7.3	0.9023
AT5G09360		LAC14	laccase 14 (.1)		Lus10026812 [exp]	8.4	0.8926
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10015743 [exp]	10.0	0.8456

Compare expression of checked genes

Lus10028003 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.